Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF ASTROTACTIN-2, A CONSERVED VERTEBRATE-SPECIFIC AND PERFORIN-LIKE MEMBRANE PROTEIN INVOLVED IN NEURONAL DEVELOPMENT
 
Authors :  T. Ni, K. Harlos, R. J. C. Gilbert
Date :  04 Apr 16  (Deposition) - 25 May 16  (Release) - 15 Jun 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.16
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Macpf, Annexin-Like, Fibronectin, Neural Guidance, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Ni, K. Harlos, R. Gilbert
Structure Of Astrotactin-2: A Conserved Vertebrate-Specific And Perforin-Like Membrane Protein Involved In Neuronal Development.
Open Biology V. 6 2016
PubMed-ID: 27249642  |  Reference-DOI: 10.1098/RSOB.160053

(-) Compounds

Molecule 1 - ASTROTACTIN-2
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemHOMO SAPIENS
    Expression System Cell LineHEK-293
    Expression System CommonHUMAN
    Expression System Taxid9606
    GeneASTN2, KIAA0634
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A   
Biological Unit 2 (1x) B  
Biological Unit 3 (1x)  C 
Biological Unit 4 (1x)   D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 48)

Asymmetric Unit (4, 48)
No.NameCountTypeFull Name
1BMA4Ligand/IonBETA-D-MANNOSE
2I3P4Ligand/IonD-MYO-INOSITOL-1,4,5-TRIPHOSPHATE
3MAN28Ligand/IonALPHA-D-MANNOSE
4NAG12Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 1 (4, 12)
No.NameCountTypeFull Name
1BMA1Ligand/IonBETA-D-MANNOSE
2I3P1Ligand/IonD-MYO-INOSITOL-1,4,5-TRIPHOSPHATE
3MAN7Ligand/IonALPHA-D-MANNOSE
4NAG3Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 2 (4, 12)
No.NameCountTypeFull Name
1BMA1Ligand/IonBETA-D-MANNOSE
2I3P1Ligand/IonD-MYO-INOSITOL-1,4,5-TRIPHOSPHATE
3MAN7Ligand/IonALPHA-D-MANNOSE
4NAG3Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 3 (4, 12)
No.NameCountTypeFull Name
1BMA1Ligand/IonBETA-D-MANNOSE
2I3P1Ligand/IonD-MYO-INOSITOL-1,4,5-TRIPHOSPHATE
3MAN7Ligand/IonALPHA-D-MANNOSE
4NAG3Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 4 (4, 12)
No.NameCountTypeFull Name
1BMA1Ligand/IonBETA-D-MANNOSE
2I3P1Ligand/IonD-MYO-INOSITOL-1,4,5-TRIPHOSPHATE
3MAN7Ligand/IonALPHA-D-MANNOSE
4NAG3Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREARG A:1124 , TRP A:1259 , MAN A:1307 , MET C:912 , ARG C:925binding site for residue I3P A 1311
02AC2SOFTWARETRP B:1259 , MAN B:1307 , LEU D:908 , GLU D:923 , ARG D:925binding site for residue I3P B 1311
03AC3SOFTWAREMET A:912 , GLU A:923 , ARG A:925 , TRP C:995 , ARG C:1124 , TRP C:1259 , MAN C:1307binding site for residue I3P C 1311
04AC4SOFTWARELEU B:908 , GLU B:923 , ARG B:925 , TRP D:1259 , MAN D:1307binding site for residue I3P D 1311
05AC5SOFTWARELYS A:717 , ASN A:719 , GLN A:741binding site for Mono-Saccharide NAG A 1310 bound to ASN A 719
06AC6SOFTWAREASN A:732 , HIS A:852 , MET A:980 , TYR A:983 , TRP A:984 , ASP A:993 , ASP A:994 , TRP A:995 , ALA A:1042 , ILE A:1043 , GLU A:1097 , LYS A:1264 , I3P A:1311binding site for Poly-Saccharide residues NAG A 1300 through MAN A 1309 bound to ASN A 732
07AC7SOFTWARELYS B:717 , ASN B:719 , GLN B:741binding site for Mono-Saccharide NAG B 1310 bound to ASN B 719
08AC8SOFTWAREASN B:732 , HIS B:852 , MET B:980 , TYR B:983 , TRP B:984 , ASP B:993 , ASP B:994 , ILE B:1043 , GLU B:1097 , I3P B:1311binding site for Poly-Saccharide residues NAG B 1300 through MAN B 1309 bound to ASN B 732
09AC9SOFTWARELYS C:717 , ASN C:719 , GLN C:741 , MET C:745binding site for Mono-Saccharide NAG C 1310 bound to ASN C 719
10AD1SOFTWAREASN C:732 , HIS C:852 , LEU C:979 , MET C:980 , TYR C:983 , TRP C:984 , ASP C:993 , ASP C:994 , ALA C:1042 , ILE C:1043 , GLU C:1097 , LYS C:1264 , I3P C:1311binding site for Poly-Saccharide residues NAG C 1300 through MAN C 1309 bound to ASN C 732
11AD2SOFTWARELYS D:717 , ASN D:719 , GLN D:741binding site for Mono-Saccharide NAG D 1310 bound to ASN D 719
12AD3SOFTWAREASN D:732 , HIS D:852 , LYS D:976 , MET D:980 , TYR D:983 , TRP D:984 , ASP D:993 , ASP D:994 , ALA D:1042 , ILE D:1043 , GLU D:1097 , I3P D:1311binding site for Poly-Saccharide residues NAG D 1300 through MAN D 1309 bound to ASN D 732

(-) SS Bonds  (32, 32)

Asymmetric Unit
No.Residues
1A:774 -A:936
2A:865 -A:926
3A:932 -A:939
4A:985 -A:996
5A:998 -A:1011
6A:1085 -A:1107
7A:1139 -A:1226
8A:1247 -A:1270
9B:774 -B:936
10B:865 -B:926
11B:932 -B:939
12B:985 -B:996
13B:998 -B:1011
14B:1085 -B:1107
15B:1139 -B:1226
16B:1247 -B:1270
17C:774 -C:936
18C:865 -C:926
19C:932 -C:939
20C:985 -C:996
21C:998 -C:1011
22C:1085 -C:1107
23C:1139 -C:1226
24C:1247 -C:1270
25D:774 -D:936
26D:865 -D:926
27D:932 -D:939
28D:985 -D:996
29D:998 -D:1011
30D:1085 -D:1107
31D:1139 -D:1226
32D:1247 -D:1270

(-) Cis Peptide Bonds  (24, 24)

Asymmetric Unit
No.Residues
1Phe A:723 -Gly A:724
2Ser A:818 -Thr A:819
3Leu A:1000 -Ser A:1001
4Leu A:1081 -Gly A:1082
5Thr A:1083 -Ser A:1084
6Pro A:1096 -Glu A:1097
7Phe B:723 -Gly B:724
8Ser B:818 -Thr B:819
9Leu B:1000 -Ser B:1001
10Leu B:1081 -Gly B:1082
11Thr B:1083 -Ser B:1084
12Pro B:1096 -Glu B:1097
13Phe C:723 -Gly C:724
14Ser C:818 -Thr C:819
15Leu C:1000 -Ser C:1001
16Leu C:1081 -Gly C:1082
17Thr C:1083 -Ser C:1084
18Pro C:1096 -Glu C:1097
19Phe D:723 -Gly D:724
20Ser D:818 -Thr D:819
21Leu D:1000 -Ser D:1001
22Leu D:1081 -Gly D:1082
23Thr D:1083 -Ser D:1084
24Pro D:1096 -Glu D:1097

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5J67)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5J67)

(-) Exons   (0, 0)

(no "Exon" information available for 5J67)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:559
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............................................eeeee.......eeee...ee.hhhhh.ee.........eeeeeeee...eeeee.....hhhhhhhhhhhhhh.hhhhhhhhhhhhh.eeeeeeeee.eeeeeeee.hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh...........eeeeeee......................eeeeeeeeee.hhhh.hhhhhhhhhhhhhhhhhh...eeee..eeee.....................ee..........eeeeee.........eeeeeeeeeee.......eeee.............eeeeeee......eeeeeee.......eeeeeeeeee........eeeeee......hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh...eeeeeeeeeeeeeeee............hhhhh.eeeeeeeeeeeeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5j67 A  717 KFNDTLFGEMLHGYNNRTQHVNQGQVFQMTFRENNFIKDFPQLADGLLVIPLPVEEQCRGVLSEPLPDLQLLTGDIRYDEAMGYPMVQQWRVRSNLYRVKLSTITLAAGFTNVLKILTKESSREELLSFIQHYGSHYIAEALYGSELTCIIHFPSKKVQQQLWLQYQKETTSMPFITYLSGLLTAQMLSDDQLISGVEIRCEEKGRCPSTCHLCRRPGKEQLSPTPVLLEINRVVPLYTLIQDNGTKEAFKSALMSSYWCSGKGDVIDDWCRCDLSAFDANGLPNCSPLLQPVLRLSPTVEPSSTVVSLEWVDVQPAIGTKVSDYILQHKKVDTDLYTGEFLSFADDLLSGLGTSCVAAGRSHGEVPEVSIYSVIFKCLEPDGLYKFTLYAVDTRGRHSELSTVTLRTACPLVDDNKAEEIADKIYNLYNGYTSGKEQQMAYNTLMEVSASMLFRVQHHYNSHYEKFGDFVWRSEDELGPRKAHLILRRLERVSSHCSSLLRSAYIQSRVETVPYLFCRSEEVRPAGMVWYSILKDTKITCEEKMVSMARNTYGESKGR 1288
                                   726       736       746       756       766       776       786       796       806       816       826       836       846       856       866       876       886||     905       915       925       935       945       955       965       975       985       995      1005      1015      1025      1035      1045      1055  ||  1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279         
                                                                                                                                                                                                    887|                                                                                                                                                             1058|                                                                                                                                                                                                                                 
                                                                                                                                                                                                     897                                                                                                                                                              1063                                                                                                                                                                                                                                 

Chain B from PDB  Type:PROTEIN  Length:558
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..............................................eeeee.......eeee...ee.hhhhh.ee.........eeeeeeee...eeeee.....hhhhhhhhhhhhhh.hhhhhhhhhhhhh.eeeeeeeee.eeeeeeee.hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh...........eeeeeee......................eeeeeeeeee.hhhh.hhhhhhhhhhhhhhhhhh...eeee..eeee.....................ee..........eeeeee.........eeeeeeeeeee.......eeee.............eeeeeee......eeeeeee.......eeeeeeeeee........eeeeee......hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh....eeeeeeeeeeeeeee............hhhhh.eeeeeeeeeeeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                5j67 B  717 KFNDTLFGEMLHGYNNRTQHVNQGQVFQMTFRENNFIKDFPQLADGLLVIPLPVEEQCRGVLSEPLPDLQLLTGDIRYDEAMGYPMVQQWRVRSNLYRVKLSTITLAAGFTNVLKILTKESSREELLSFIQHYGSHYIAEALYGSELTCIIHFPSKKVQQQLWLQYQKETTSMPFITYLSGLLTAQMLSDDQLISGVEIRCEEKGRCPSTCHLCRRPGKEQLSPTPVLLEINRVVPLYTLIQDNGTKEAFKSALMSSYWCSGKGDVIDDWCRCDLSAFDANGLPNCSPLLQPVLRLSPTVEPSSTVVSLEWVDVQPAIGTKVSDYILQHKKVDTDLYTGEFLSFADDLLSGLGTSCVAAGRSHGEVPEVSIYSVIFKCLEPDGLYKFTLYAVDTRGRHSELSTVTLRTACPLVDDNKAEEIADKIYNLYNGYTSGKEQQMAYNTLMEVSASMLFRVQHHYNSHYEKFGDFVWRSEDELGPRKAHLILRRLERVSSHCSSLLRSAYIQSRVETVPYLFCRSEEVRPAGMVWYSILKDTKITCEEKMVSMARNTYGESKG 1287
                                   726       736       746       756       766       776       786       796       806       816       826       836       846       856       866       876       886||     905       915       925       935       945       955       965       975       985       995      1005      1015      1025      1035      1045      1055  ||  1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279        
                                                                                                                                                                                                    887|                                                                                                                                                             1058|                                                                                                                                                                                                                                
                                                                                                                                                                                                     897                                                                                                                                                              1063                                                                                                                                                                                                                                

Chain C from PDB  Type:PROTEIN  Length:563
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............................................eeeee.......eeee...ee.hhhhh.ee.........eeeeeeee...eeeee.....hhhhhhhhhhhhhh.hhhhhhhhhhhhh.eeeeeeeee.eeeeeeee.hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh...........eeeeeee......................eeeeeeeeee.hhhh.hhhhhhhhhhhhhhhhhh...eeee..eeee.....................ee..........eeeeee.........eeeeeeeeeee...........eeee.............eeeeeee......eeeeeee.......eeeeeeeeee........eeeeee......hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh....eeeeeeeeeeeeeee............hhhhh.eeeeeeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5j67 C  717 KFNDTLFGEMLHGYNNRTQHVNQGQVFQMTFRENNFIKDFPQLADGLLVIPLPVEEQCRGVLSEPLPDLQLLTGDIRYDEAMGYPMVQQWRVRSNLYRVKLSTITLAAGFTNVLKILTKESSREELLSFIQHYGSHYIAEALYGSELTCIIHFPSKKVQQQLWLQYQKETTSMPFITYLSGLLTAQMLSDDQLISGVEIRCEEKGRCPSTCHLCRRPGKEQLSPTPVLLEINRVVPLYTLIQDNGTKEAFKSALMSSYWCSGKGDVIDDWCRCDLSAFDANGLPNCSPLLQPVLRLSPTVEPSSTVVSLEWVDVQPAIGTKVSDYILQHKKVDEYTDTDLYTGEFLSFADDLLSGLGTSCVAAGRSHGEVPEVSIYSVIFKCLEPDGLYKFTLYAVDTRGRHSELSTVTLRTACPLVDDNKAEEIADKIYNLYNGYTSGKEQQMAYNTLMEVSASMLFRVQHHYNSHYEKFGDFVWRSEDELGPRKAHLILRRLERVSSHCSSLLRSAYIQSRVETVPYLFCRSEEVRPAGMVWYSILKDTKITCEEKMVSMARNTYGESKGR 1288
                                   726       736       746       756       766       776       786       796       806       816       826       836       846       856       866       876       886||     905       915       925       935       945       955       965       975       985       995      1005      1015      1025      1035      1045      1055      1065      1075      1085      1095      1105      1115      1125      1135      1145      1155      1165      1175      1185      1195      1205      1215      1225      1235      1245      1255      1265      1275      1285   
                                                                                                                                                                                                    887|                                                                                                                                                                                                                                                                                                                                                                                                       
                                                                                                                                                                                                     897                                                                                                                                                                                                                                                                                                                                                                                                       

Chain D from PDB  Type:PROTEIN  Length:557
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............................................eeeee.......eeee...ee.hhhhh.ee.........eeeeeeee...eeeee.....hhhhhhhhhhhhhh.hhhhhhhhhhhhh.eeeeeeeee.eeeeeeee.hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh...........eeeeeee......................eeeeeeeeee.hhhh.hhhhhhhhhhhhhhhhhh...eeee..eeee.....................ee..........eeeeee.........eeeeeeeeee.........eeee.............eeeeeee......eeeeeee.......eeeeeeeeee........eeeeee......hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh...eeeeeeeeeeeeeeee............hhhhh.eeeeeeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5j67 D  717 KFNDTLFGEMLHGYNNRTQHVNQGQVFQMTFRENNFIKDFPQLADGLLVIPLPVEEQCRGVLSEPLPDLQLLTGDIRYDEAMGYPMVQQWRVRSNLYRVKLSTITLAAGFTNVLKILTKESSREELLSFIQHYGSHYIAEALYGSELTCIIHFPSKKVQQQLWLQYQKETTSMPFITYLSGLLTAQMLSDDQLISGVEIRCEEKGRCPSTCHLCRRPGKEQLSPTPVLLEINRVVPLYTLIQDNGTKEAFKSALMSSYWCSGKGDVIDDWCRCDLSAFDANGLPNCSPLLQPVLRLSPTVEPSSTVVSLEWVDVQPAIGTKVSDYILQHKKVDETDLYTGEFLSFADDLLSGLGTSCVAAGRSHGEVPEVSIYSVIFKCLEPDGLYKFTLYAVDTRGRHSELSTVTLRTACPLVDDNKAEEIADKIYNLYNGYTSGKEQQMAYNTLMEVSASMLFRVQHHYNSHYEKFGDFVWRSEDELGPRKAHLILRRLERVSSHCSSLLRSAYIQSRVETVPYLFCRSEEVRPAGMVWYSILKDTKITCEEKMVSMARNTYGES 1285
                                   726       736       746       756       766       776       786       796       806       816       826       836       846       856       866       876       886||     905       915       925       935       945       955       965       975       985       995      1005      1015      1025      1035      1045      1055   || 1068      1078      1088      1098      1108      1118      1128      1138      1148      1158      1168      1178      1188      1198      1208      1218      1228      1238      1248      1258      1268      1278       
                                                                                                                                                                                                    887|                                                                                                                                                              1059|                                                                                                                                                                                                                              
                                                                                                                                                                                                     897                                                                                                                                                               1063                                                                                                                                                                                                                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5J67)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5J67)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5J67)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    I3P  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu A:1000 - Ser A:1001   [ RasMol ]  
    Leu A:1081 - Gly A:1082   [ RasMol ]  
    Leu B:1000 - Ser B:1001   [ RasMol ]  
    Leu B:1081 - Gly B:1082   [ RasMol ]  
    Leu C:1000 - Ser C:1001   [ RasMol ]  
    Leu C:1081 - Gly C:1082   [ RasMol ]  
    Leu D:1000 - Ser D:1001   [ RasMol ]  
    Leu D:1081 - Gly D:1082   [ RasMol ]  
    Phe A:723 - Gly A:724   [ RasMol ]  
    Phe B:723 - Gly B:724   [ RasMol ]  
    Phe C:723 - Gly C:724   [ RasMol ]  
    Phe D:723 - Gly D:724   [ RasMol ]  
    Pro A:1096 - Glu A:1097   [ RasMol ]  
    Pro B:1096 - Glu B:1097   [ RasMol ]  
    Pro C:1096 - Glu C:1097   [ RasMol ]  
    Pro D:1096 - Glu D:1097   [ RasMol ]  
    Ser A:818 - Thr A:819   [ RasMol ]  
    Ser B:818 - Thr B:819   [ RasMol ]  
    Ser C:818 - Thr C:819   [ RasMol ]  
    Ser D:818 - Thr D:819   [ RasMol ]  
    Thr A:1083 - Ser A:1084   [ RasMol ]  
    Thr B:1083 - Ser B:1084   [ RasMol ]  
    Thr C:1083 - Ser C:1084   [ RasMol ]  
    Thr D:1083 - Ser D:1084   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5j67
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ASTN2_HUMAN | O75129
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ASTN2_HUMAN | O75129
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ASTN2_HUMAN | O751295j68 5j69

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5J67)