Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  X-RAY CRYSTAL STRUCTURE OF ACETYLCHOLINE BINDING PROTEIN (ACHBP) IN COMPLEX WITH N4,N4-BIS[(PYRIDIN-2-YL)METHYL]-6-(THIOPHEN-3-YL) PYRIMIDINE-2,4-DIAMINE
 
Authors :  K. Kaczanowska, G. A. Camacho Hernandez, M. Harel, P. Taylor
Date :  02 Apr 16  (Deposition) - 08 Mar 17  (Release) - 22 Mar 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.04
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J
Biol. Unit 1:  A,B,C,D,E  (1x)
Biol. Unit 2:  F,G,H,I,J  (1x)
Keywords :  Acetylcholine-Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Kaczanowska, G. A. Camacho Hernandez, L. Bendiks, L. Kohs, J. M. Cornejo-Bravo, M. Harel, M. G. Finn, P. Taylor
Substituted 2-Aminopyrimidines Selective For Alpha 7-Nicotinic Acetylcholine Receptor Activation And Association With Acetylcholine Binding Proteins.
J. Am. Chem. Soc. V. 139 3676 2017
PubMed-ID: 28221788  |  Reference-DOI: 10.1021/JACS.6B10746

(-) Compounds

Molecule 1 - ACETYLCHOLINE-BINDING PROTEIN
    ChainsA, B, C, D, E, F, G, H, I, J
    EngineeredYES
    Expression SystemHOMO SAPIENS
    Expression System Cell LineHEK293S GNT1
    Expression System PlasmidPFLAG-CMV3
    Expression System Taxid9606
    Organism CommonGREAT POND SNAIL
    Organism ScientificLYMNAEA STAGNALIS
    Organism Taxid6523
    SynonymACHBP

 Structural Features

(-) Chains, Units

  12345678910
Asymmetric Unit ABCDEFGHIJ
Biological Unit 1 (1x)ABCDE     
Biological Unit 2 (1x)     FGHIJ

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 34)

Asymmetric Unit (5, 34)
No.NameCountTypeFull Name
16GH10Ligand/IonN~4~,N~4~-BIS[(PYRIDIN-2-YL)METHYL]-6-(THIOPHEN-3-YL)PYRIMIDINE-2,4-DIAMINE
2DMS1Ligand/IonDIMETHYL SULFOXIDE
3GOL2Ligand/IonGLYCEROL
4NAG10Ligand/IonN-ACETYL-D-GLUCOSAMINE
5PO411Ligand/IonPHOSPHATE ION
Biological Unit 1 (3, 16)
No.NameCountTypeFull Name
16GH5Ligand/IonN~4~,N~4~-BIS[(PYRIDIN-2-YL)METHYL]-6-(THIOPHEN-3-YL)PYRIMIDINE-2,4-DIAMINE
2DMS-1Ligand/IonDIMETHYL SULFOXIDE
3GOL-1Ligand/IonGLYCEROL
4NAG5Ligand/IonN-ACETYL-D-GLUCOSAMINE
5PO46Ligand/IonPHOSPHATE ION
Biological Unit 2 (5, 18)
No.NameCountTypeFull Name
16GH5Ligand/IonN~4~,N~4~-BIS[(PYRIDIN-2-YL)METHYL]-6-(THIOPHEN-3-YL)PYRIMIDINE-2,4-DIAMINE
2DMS1Ligand/IonDIMETHYL SULFOXIDE
3GOL2Ligand/IonGLYCEROL
4NAG5Ligand/IonN-ACETYL-D-GLUCOSAMINE
5PO45Ligand/IonPHOSPHATE ION

(-) Sites  (34, 34)

Asymmetric Unit (34, 34)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREARG A:3 , VAL A:74 , SER A:75 , ASP E:17 , VAL E:18 , ILE E:19 , HIS E:145 , HOH E:468binding site for residue PO4 A 301
02AC2SOFTWARETRP A:143 , TYR A:185 , CYS A:187 , CYS A:188 , TYR A:192 , GLN B:55 , THR B:57 , ARG B:104 , LEU B:112 , MET B:114 , TYR B:164binding site for residue 6GH A 303
03AC3SOFTWAREASP A:17 , VAL A:18 , ILE A:19 , HIS A:145 , ARG B:3 , VAL B:74 , SER B:75binding site for residue PO4 B 301
04AC4SOFTWAREASP B:17 , VAL B:18 , ILE B:19 , HIS B:145 , ARG C:3 , VAL C:74 , SER C:75binding site for residue PO4 B 302
05AC5SOFTWAREASP B:-7 , LYS B:-5 , ASP B:-4 , HIS B:69 , NAG F:303 , ASP H:160 , SER H:162binding site for residue PO4 B 303
06AC6SOFTWARETRP B:143 , TYR B:185 , CYS B:187 , CYS B:188 , TYR B:192 , GLN C:55 , THR C:57 , ARG C:104 , LEU C:112 , MET C:114 , TYR C:164binding site for residue 6GH B 305
07AC7SOFTWAREASP C:17 , VAL C:18 , ILE C:19 , HIS C:145 , ARG D:3 , VAL D:74 , SER D:75binding site for residue PO4 C 301
08AC8SOFTWARETYR C:89 , TRP C:143 , THR C:144 , TYR C:185 , CYS C:187 , CYS C:188 , TYR C:192 , GLN D:55 , THR D:57 , LEU D:112 , MET D:114 , TYR D:164binding site for residue 6GH C 303
09AC9SOFTWAREASP D:17 , VAL D:18 , ILE D:19 , HIS D:145 , ARG E:3 , VAL E:74 , SER E:75binding site for residue PO4 D 301
10AD1SOFTWARETRP D:143 , TYR D:185 , CYS D:187 , CYS D:188 , TYR D:192 , GLN E:55 , THR E:57 , LEU E:112 , MET E:114 , TYR E:164binding site for residue 6GH D 303
11AD2SOFTWAREGLN A:55 , THR A:57 , LEU A:112 , MET A:114 , TYR A:164 , TRP E:143 , CYS E:187 , CYS E:188 , TYR E:192binding site for residue 6GH E 302
12AD3SOFTWAREARG F:3 , VAL F:74 , SER F:75 , ASP J:17 , VAL J:18 , ILE J:19 , HIS J:145binding site for residue PO4 F 301
13AD4SOFTWAREASP F:17 , VAL F:18 , ILE F:19 , HIS F:145 , ARG G:3 , VAL G:74 , SER G:75binding site for residue PO4 F 302
14AD5SOFTWAREGLN F:54 , LEU F:86 , PRO F:95 , GLN F:119 , HOH F:407 , HOH F:423binding site for residue GOL F 304
15AD6SOFTWARETRP F:143 , TYR F:185 , CYS F:187 , CYS F:188 , TYR F:192 , GLN G:55 , THR G:57 , LEU G:112 , MET G:114 , TYR G:164binding site for residue 6GH F 305
16AD7SOFTWARETYR G:89 , TRP G:143 , TYR G:185 , CYS G:187 , CYS G:188 , TYR G:192 , GLN H:55 , THR H:56 , THR H:57 , LEU H:112 , MET H:114 , TYR H:164binding site for residue 6GH G 302
17AD8SOFTWAREASP G:17 , VAL G:18 , ILE G:19 , HIS G:145 , ARG H:3 , VAL H:74 , SER H:75binding site for residue PO4 H 301
18AD9SOFTWAREPRO H:16 , LEU H:81 , TRP H:82 , VAL H:83 , ASP H:85 , HOH H:403 , HOH H:442binding site for residue GOL H 303
19AE1SOFTWARETRP H:143 , TYR H:185 , CYS H:187 , CYS H:188 , TYR H:192 , GLN I:55 , THR I:57 , ARG I:104 , LEU I:112 , MET I:114 , TYR I:164binding site for residue 6GH H 304
20AE2SOFTWAREASP E:5 , ASN H:9 , ASN H:66 , SER H:70binding site for residue DMS H 305
21AE3SOFTWAREASP H:17 , VAL H:18 , ILE H:19 , HIS H:145 , ARG I:3 , VAL I:74 , SER I:75binding site for residue PO4 I 301
22AE4SOFTWAREASP I:17 , VAL I:18 , ILE I:19 , HIS I:145 , ARG J:3 , VAL J:74 , SER J:75binding site for residue PO4 I 302
23AE5SOFTWARETRP I:143 , TYR I:185 , CYS I:187 , CYS I:188 , TYR I:192 , GLN J:55 , THR J:57 , ARG J:104 , LEU J:112 , MET J:114 , TYR J:164binding site for residue 6GH I 304
24AE6SOFTWAREGLN F:55 , THR F:57 , LEU F:112 , MET F:114 , TYR F:164 , TRP J:143 , TYR J:185 , CYS J:187 , CYS J:188 , TYR J:192binding site for residue 6GH J 302
25AE7SOFTWAREASN A:66 , ASP G:-4binding site for Mono-Saccharide NAG A 302 bound to ASN A 66
26AE8SOFTWAREASN B:66 , SER B:68 , HIS B:69 , LEU H:174 , ASP H:175 , ASN H:200binding site for Mono-Saccharide NAG B 304 bound to ASN B 66
27AE9SOFTWAREASN C:66 , SER C:68 , HIS C:69binding site for Mono-Saccharide NAG C 302 bound to ASN C 66
28AF1SOFTWAREASN D:66 , SER D:68 , HIS D:69binding site for Mono-Saccharide NAG D 302 bound to ASN D 66
29AF2SOFTWAREASN E:66 , SER E:68 , HIS E:69binding site for Mono-Saccharide NAG E 301 bound to ASN E 66
30AF3SOFTWAREPO4 B:303 , ASN F:66 , SER F:68 , HIS F:69binding site for Mono-Saccharide NAG F 303 bound to ASN F 66
31AF4SOFTWAREHOH A:404 , ASN G:66 , SER G:68binding site for Mono-Saccharide NAG G 301 bound to ASN G 66
32AF5SOFTWAREASP E:-4 , ASN H:66 , SER H:68 , HIS H:69binding site for Mono-Saccharide NAG H 302 bound to ASN H 66
33AF6SOFTWAREASN I:66 , SER I:68binding site for Mono-Saccharide NAG I 303 bound to ASN I 66
34AF7SOFTWAREASP C:-4 , ASN J:66 , SER J:68binding site for Mono-Saccharide NAG J 301 bound to ASN J 66

(-) SS Bonds  (20, 20)

Asymmetric Unit
No.Residues
1A:123 -A:136
2A:187 -A:188
3B:123 -B:136
4B:187 -B:188
5C:123 -C:136
6C:187 -C:188
7D:123 -D:136
8D:187 -D:188
9E:123 -E:136
10E:187 -E:188
11F:123 -F:136
12F:187 -F:188
13G:123 -G:136
14G:187 -G:188
15H:123 -H:136
16H:187 -H:188
17I:123 -I:136
18I:187 -I:188
19J:123 -J:136
20J:187 -J:188

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Lys H:204 -Gly H:205

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5J5F)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5J5F)

(-) Exons   (0, 0)

(no "Exon" information available for 5J5F)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:212
                                                                                                                                                                                                                                                    
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh.hhhhhhhhhhhhhhhh............eeeeeeeeeeeeeeee....eeeeeeeeeeeee.hhhh........eeeee.hhh....eee.......ee....eeeee...eeee..eeeeeee...........eeeeeeeee.......eeee......hhhhh......eeeeeeeeeeeeeee..eeeeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5j5f A  -7 DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKK 204
                                     2        12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202  

Chain B from PDB  Type:PROTEIN  Length:213
                                                                                                                                                                                                                                                     
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh.hhhhhhhhhhhhhhhh............eeeeeeeeeeeeeeee....eeeeeeeeeeeee.hhhh........eeeee.hhh....eee.......ee....eeeee...eeee..eeeeeee...........eeeeeeeee.......eeeee...ee...........eeeeeeeeeeeeeee..eeeeeeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5j5f B  -7 DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG 205
                                     2        12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202   

Chain C from PDB  Type:PROTEIN  Length:213
                                                                                                                                                                                                                                                     
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh.hhhhhhhhhhhhhhhh............eeeeeeeeeeeeeeee....eeeeeeeeeeeee.hhhh........eeeee.hhh....eee.......ee....eeeee...eeee..eeeeeee...........eeeeeeeee.......eeeee...ee...........eeeeeeeeeeeeeee..eeeeeeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5j5f C  -7 DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG 205
                                     2        12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202   

Chain D from PDB  Type:PROTEIN  Length:216
                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhh.hhhhhhhhhhhhhhhh............eeeeeeeeeeeeeeee....eeeeeeeeeeeee.hhhh........eeeee.hhh....eee.......ee....eeeee...eeee..eeeeeee...........eeeeeeeee.......eeeee..............eeeeeeeeeeeeeee..eeeeeeeeeeeeeeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5j5f D  -7 DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTNSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL 210
                                     2        12        22        32        42        52        62        72        82        92       102       112       122       132       142       152  ||   164       174       184       194       204      
                                                                                                                                                                                            155|                                                    
                                                                                                                                                                                             158                                                    

Chain E from PDB  Type:PROTEIN  Length:218
                                                                                                                                                                                                                                                          
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh.hhhhhhhhhhhhhhhh............eeeeeeeeeeeeeeee....eeeeeeeeeeeee.hhhh........eeeee.hhh....eee.......ee....eeeee...eeee..eeeeeee...........eeeeeeeee.......eeeee...ee...........eeeeeeeeeeeeeee..eeeeeeeeeeeeeeee....... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5j5f E  -7 DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL 210
                                     2        12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202        

Chain F from PDB  Type:PROTEIN  Length:213
                                                                                                                                                                                                                                                     
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhh............eeeeeeeeeeeeeeee....eeeeeeeeeeeee.hhhh........eeeee.hhh....eee.......ee....eeeee...eeee..eeeeeee...........eeeeeeeee.......eeeee............eeeeeeeeeeeeeee..eeeeeeeeeeeeeeee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5j5f F  -6 YKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL 210
                                     3        13        23        33        43        53        63        73        83        93       103       113       123       133       143       153 ||    167       177       187       197       207   
                                                                                                                                                                                           155|                                                  
                                                                                                                                                                                            160                                                  

Chain G from PDB  Type:PROTEIN  Length:212
                                                                                                                                                                                                                                                    
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh.hhhhhhhhhhhhhhhh............eeeeeeeeeeeeeeee....eeeeeeeeeeeee.hhhh........eeeee.hhh....eee.......ee....eeeee...eeee..eeeeeee...........eeeeeeeee.......eeeee....hhhhh......eeeeeeeeeeeeeee..eeeeeeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5j5f G  -7 DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTNSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG 205
                                     2        12        22        32        42        52        62        72        82        92       102       112       122       132       142       152   ||  163       173       183       193       203  
                                                                                                                                                                                             156|                                               
                                                                                                                                                                                              158                                               

Chain H from PDB  Type:PROTEIN  Length:213
                                                                                                                                                                                                                                                     
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh.hhhhhhhhhhhhhhhh............eeeeeeeeeeeeeeee....eeeeeeeeeeeee.hhhh........eeeee.hhh....eee.......ee....eeeee...eeee..eeeeeee...........eeeeeeeee.......eeeee................eeeeeeeeeeeeeee..eeeeeeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5j5f H  -7 DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG 205
                                     2        12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202   

Chain I from PDB  Type:PROTEIN  Length:213
                                                                                                                                                                                                                                                     
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh.hhhhhhhhhhhhhhhh............eeeeeeeeeeeeeeee....eeeeeeeeeeeee.hhhh........eeeee.hhh....eee.......ee....eeeee...eeee..eeeeeee...........eeeeeeeee.......eeeee...ee...........eeeeeeeeeeeeeee..eeeeeeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5j5f I  -7 DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG 205
                                     2        12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202   

Chain J from PDB  Type:PROTEIN  Length:213
                                                                                                                                                                                                                                                     
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh.hhhhhhhhhhhhhhhh............eeeeeeeeeeeeeeee....eeeeeeeeeeeee.hhhh........eeeee.hhh....eee.......ee....eeeee...eeee..eeeeeee...........eeeeeeeee.......eeeee...ee...........eeeeeeeeeeeeeee..eeeeeeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5j5f J  -7 DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG 205
                                     2        12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5J5F)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5J5F)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5J5F)

(-) Gene Ontology  (9, 9)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    6GH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DMS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Lys H:204 - Gly H:205   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5j5f
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ACHP_LYMST | P58154
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ACHP_LYMST | P58154
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ACHP_LYMST | P581541i9b 1uv6 1uw6 1ux2 1yi5 2zju 2zjv 3u8j 3u8k 3u8l 3u8m 3u8n 3wip 3wth 3wti 3wtj 3wtk 3wtl 3wtm 3wtn 3wto 3zdg 3zdh 4alx 4hqp 4nzb 4qaa 4qab 4qac 4um1 4um3 4zjt 4zk1 4zr6 4zru 5afh 5afj 5afk 5afl 5afm 5afn 5bp0 5j5g 5j5h 5j5i 5t90

(-) Related Entries Specified in the PDB File

4qaa 4qab 4qac 5j5g 5j5h 5j5i