Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE EXTRACELLULAR DOMAIN OF ALPHA2 NICOTINIC ACETYLCHOLINE RECEPTOR IN PENTAMERIC ASSEMBLY
 
Authors :  P. Giastas, N. Kouvatsos, D. Chroni-Tzartou, S. J. Tzartos
Date :  13 Oct 15  (Deposition) - 10 Aug 16  (Release) - 28 Sep 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.20
Chains :  Asym./Biol. Unit :  A,B,C,D,E
Keywords :  Acetylcholine-Binding Protein, Nachr, Extracellular Domain, Nicotinic Acetylcholine Receptor, Epibatidine, Agonist, Alpha2 (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  N. Kouvatsos, P. Giastas, D. Chroni-Tzartou, C. Poulopoulou, S. J. Tzartos
Crystal Structure Of A Human Neuronal Nachr Extracellular Domain In Pentameric Assembly: Ligand-Bound Alpah2 Homopentamer.
Proc. Natl. Acad. Sci. Usa V. 113 9635 2016
PubMed-ID: 27493220  |  Reference-DOI: 10.1073/PNAS.1602619113

(-) Compounds

Molecule 1 - NEURONAL ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-2
    ChainsA, B, C, D, E
    EngineeredYES
    Expression SystemPICHIA PASTORIS
    Expression System StrainX33
    Expression System Taxid4922
    Expression System VectorPPICZA
    FragmentEXTRACELLULAR DOMAIN, RESIDUES 59-265
    OrganBRAIN
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymALPHA2 ECD NACHR

 Structural Features

(-) Chains, Units

  12345
Asymmetric/Biological Unit ABCDE

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 5)

Asymmetric/Biological Unit (1, 5)
No.NameCountTypeFull Name
1EPJ5Ligand/IonEPIBATIDINE

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:122 , TRP A:178 , THR A:179 , TYR A:219 , TYR A:226 , TRP B:84 , LYS B:136 , HIS B:146 , VAL B:148BINDING SITE FOR RESIDUE EPJ A 300
2AC2SOFTWARETYR B:122 , TRP B:178 , THR B:179 , TYR B:219 , CYS B:222 , TYR B:226 , TRP C:84 , LYS C:136 , HIS C:146 , VAL C:148BINDING SITE FOR RESIDUE EPJ B 300
3AC3SOFTWARETYR C:122 , TRP C:178 , THR C:179 , TYR C:226 , TRP D:84 , LYS D:136 , HIS D:138 , HIS D:146 , VAL D:148BINDING SITE FOR RESIDUE EPJ C 300
4AC4SOFTWARETYR D:122 , TRP D:178 , THR D:179 , TYR D:219 , TYR D:226 , LYS E:136 , HIS E:146 , VAL E:148BINDING SITE FOR RESIDUE EPJ D 300
5AC5SOFTWARETRP A:84 , LYS A:136 , HIS A:146 , VAL A:148 , TYR E:122 , TRP E:178 , THR E:179 , TYR E:219 , CYS E:222 , TYR E:226BINDING SITE FOR RESIDUE EPJ E 300

(-) SS Bonds  (9, 9)

Asymmetric/Biological Unit
No.Residues
1A:157 -A:171
2A:221 -A:222
3B:157 -B:171
4B:221 -B:222
5C:157 -C:171
6C:221 -C:222
7D:157 -D:171
8D:221 -D:222
9E:157 -E:171

(-) Cis Peptide Bonds  (9, 9)

Asymmetric/Biological Unit
No.Residues
1Asp A:56 -Val A:57
2His A:133 -Met A:134
3Asp B:73 -Glu B:74
4Glu B:74 -Lys B:75
5His B:133 -Met B:134
6Asn C:103 -Ile C:104
7His C:133 -Met C:134
8His D:133 -Met D:134
9His E:133 -Met E:134

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5FJV)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5FJV)

(-) Exons   (0, 0)

(no "Exon" information available for 5FJV)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:207
                                                                                                                                                                                                                                               
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhh.............eeeeeeeeeeeeeeee....eeeeeeeeeeeee.hhhh..........eeeee........eee..............eeeee...eeee..eeeeeee..ee.......ee..eeeeee.......eeeee.....................eeeeeeeee..eeeeeeeeeee..ee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5fjv A  34 DRLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMEQTVDLKDYWESGEWAIVNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPH 240
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       

Chain B from PDB  Type:PROTEIN  Length:208
                                                                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhh.................eeeeeeeeeeeeeee......eeeeeeeeeeee.hhhh.hhhhh....eeee..........ee...............eeee...eeee..eeeeee..............eeeeeee........eeeee...................eeeeeee..ee..eeee..eeeeeee...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5fjv B  33 EDRLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMEQTVDLKDYWESGEWAIVNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPH 240
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232        

Chain C from PDB  Type:PROTEIN  Length:208
                                                                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh.............eeeeeeeeeeeeeeee....eeeeeeeeeeeee.hhhh.hhhhh......eee........eee..............eeee....eeee..eeeeeee...........eeeeeeeeee.......eeeee....................eeeeeeeeee..eeeeeeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5fjv C  33 EDRLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMEQTVDLKDYWESGEWAIVNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPH 240
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232        

Chain D from PDB  Type:PROTEIN  Length:205
                                                                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhh.............eeeeeeeeeeeeeee.....eeeeeeeeeeeee.hhhh.hhhhh.....eee.........eee...............eee....eeee..eeeeeee............eeeeee.......eeeee....................eeeeeeeeee..eeeeeeeeeeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5fjv D  33 EDRLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYKSSCSIDVTFDQQNCKMKFGSWTYDKAKIDLEQMEQTVDLKDYWESGEWAIVNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPH 240
                                    42        52        62        72        82        92       102       112       122       132       142       152       162||     175       185       195       205       215       225       235     
                                                                                                                                                            163|                                                                         
                                                                                                                                                             167                                                                         

Chain E from PDB  Type:PROTEIN  Length:208
                                                                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh.............eeeeeeeeeeeeeeee....eeeeeeeeeeeee.hhhh.hhhhh....eeee.........eee...............eeee...eeee..eeeeeee...............eeeeee.......eeeee.....................eeeeeeeee..eeeeeeeeeee........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5fjv E  33 EDRLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMEQTVDLKDYWESGEWAIVNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPH 240
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5FJV)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5FJV)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5FJV)

(-) Gene Ontology  (23, 23)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    EPJ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn C:103 - Ile C:104   [ RasMol ]  
    Asp A:56 - Val A:57   [ RasMol ]  
    Asp B:73 - Glu B:74   [ RasMol ]  
    Glu B:74 - Lys B:75   [ RasMol ]  
    His A:133 - Met A:134   [ RasMol ]  
    His B:133 - Met B:134   [ RasMol ]  
    His C:133 - Met C:134   [ RasMol ]  
    His D:133 - Met D:134   [ RasMol ]  
    His E:133 - Met E:134   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5fjv
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ACHA2_HUMAN | Q15822
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ACHA2_HUMAN | Q15822
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5FJV)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5FJV)