Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF HUMAN PLASMA KALLIKREIN IN COMPLEX WITH ITS PEPTIDE INHIBITOR PKALIN-3
 
Authors :  M. Xu, L. Jiang, P. Xu, Z. Luo, P. Andreasen, M. Huang
Date :  09 Dec 15  (Deposition) - 14 Dec 16  (Release) - 14 Dec 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.55
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Peptide Inhibitor, Hydrolase-Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Xu, L. Jiang, P. Xu, Z. Luo, P. Andreasen, M. Huang
The Crystal Structure Of Human Plasma Kallikrein In Complex With Its Peptide Inhibitor Pkalin-3
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PLASMA KALLIKREIN
    ChainsA
    EC Number3.4.21.34
    EngineeredYES
    Expression SystemKOMAGATAELLA PASTORIS
    Expression System Taxid4922
    FragmentUNP RESIDUES 391-629
    GeneKLKB1, KLK3
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymFLETCHER FACTOR,KININOGENIN,PLASMA PREKALLIKREIN,PKK
 
Molecule 2 - CYS-PRO-ALA-ARG-PHE-M70-ALA-LEU-TRP-CYS
    ChainsB
    EngineeredYES
    Organism ScientificSYNTHETIC CONSTRUCT
    Organism Taxid32630
    SyntheticYES

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 9)

Asymmetric/Biological Unit (2, 9)
No.NameCountTypeFull Name
1MRZ1Ligand/IonPIPERIDINE-1-CARBOXIMIDAMIDE
2SO48Ligand/IonSULFATE ION

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:60B , PRO A:60C , MET A:235 , HOH A:427 , HOH A:447binding site for residue SO4 A 301
2AC2SOFTWAREGLY A:69 , THR A:115 , GLN A:118 , HOH A:439binding site for residue SO4 A 302
3AC3SOFTWAREGLU A:26 , TRP A:137 , LYS A:157 , HOH A:494binding site for residue SO4 A 303
4AC4SOFTWARETRP A:24 , GLY A:25 , TRP A:27 , GLY A:69 , ILE A:70 , LEU A:71 , PHE A:117 , LEU A:155 , HOH A:431binding site for residue SO4 A 304
5AC5SOFTWARELEU A:37 , THR A:38 , ALA A:38A , ARG A:39 , LYS A:119 , LYS A:185binding site for residue SO4 A 305
6AC6SOFTWARETRP A:24 , PHE A:117 , ASN A:159 , PRO A:161 , TYR A:184A , HOH A:549binding site for residue SO4 A 306
7AC7SOFTWAREGLN A:34 , GLN A:38B , LEU A:73 , ILE A:76binding site for residue SO4 A 307
8AC8SOFTWARETYR A:184A , GLY A:186A , LYS A:186C , HOH A:532binding site for residue SO4 A 308
9AC9SOFTWAREASP A:189 , ALA A:190 , THR A:213 , TRP A:215 , GLY A:219 , GLY A:226 , HOH A:499 , PHE B:5 , ALA B:6binding site for residue MRZ B 100

(-) SS Bonds  (5, 5)

Asymmetric/Biological Unit
No.Residues
1A:42 -A:58
2A:136 -A:201
3A:168 -A:182
4A:191 -A:220
5B:1 -B:10

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Gln A:173 -Asp A:173A

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5F8X)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5F8X)

(-) Exons   (0, 0)

(no "Exon" information available for 5F8X)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:239
                                                                                                                                                                                                                                                                                
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeeee...eeeeeeeeeee..eeeehhhhhh...hhh.eeee....hhhhh........eeeeee.............eeeee....................hhhhh..eeeee..............eeee..eehhhhhhhh.........eeee................eeeeee..eeeeeeeeee..........eeeee...hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5f8x A   16 IVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPISLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSD  246
                                    25        35   ||   43        53       60C |||||  69        79        89        99       109       119       129       139       150       160       170   |   179     |186B||     197      208C|      217|  |   227       237         
                                                 38A|                    60A|| |||||                                                                                148|                    173A        184A  ||||             205|||      217|  |                         
                                                  38B                     60B| |||||                                                                                 150                                   186A|||             208B||       219  |                         
                                                                           60C |||||                                                                                                                        186B||              208C|         221A                         
                                                                              62||||                                                                                                                         186C|               208D                                      
                                                                              65B|||                                                                                                                           189                                                         
                                                                               65C||                                                                                                                                                                                       
                                                                                65D|                                                                                                                                                                                       
                                                                                 65E                                                                                                                                                                                       

Chain B from PDB  Type:PROTEIN  Length:10
                                           
               SCOP domains ---------- SCOP domains
               CATH domains ---------- CATH domains
               Pfam domains ---------- Pfam domains
         Sec.struct. author .......... Sec.struct. author
                 SAPs(SNPs) ---------- SAPs(SNPs)
                    PROSITE ---------- PROSITE
                 Transcript ---------- Transcript
                5f8x B    1 CPARFAALWC   10
                                    10

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5F8X)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5F8X)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5F8X)

(-) Gene Ontology  (21, 21)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MRZ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gln A:173 - Asp A:173A  [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5f8x
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KLKB1_HUMAN | P03952
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.34
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  KLKB1_HUMAN | P03952
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KLKB1_HUMAN | P039522anw 2any 4ogx 4ogy 5f8t 5f8z 5tjx

(-) Related Entries Specified in the PDB File

5f8t 5f8z