Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  RADIATION DAMAGE TO THE TRAP-RNA COMPLEX: DOSE (DWD) 3.88 MGY
 
Authors :  C. S. Bury, J. E. Mcgeehan, E. F. Garman, M. B. Shevtsov
Date :  23 Oct 15  (Deposition) - 04 May 16  (Release) - 11 May 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.98
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W
Biol. Unit 1:  A,B,C,D,E,F,G,H,I,J,K  (1x)
Biol. Unit 2:  L,M,N,O,P,Q,R,S,T,U,V,W  (1x)
Keywords :  Protein-Rna Complex, Radiation Damage, Rna-Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. S. Bury, J. E. Mcgeehan, A. A. Antson, I. Carmichael, M. Gerstel, M. B. Shevtsov, E. F. Garman
Rna Protects A Nucleoprotein Complex Against Radiation Damage.
Acta Crystallogr D Struct V. 72 648 2016 Biol
PubMed-ID: 27139628  |  Reference-DOI: 10.1107/S2059798316003351
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TRANSCRIPTION ATTENUATION PROTEIN MTRB
    ChainsA, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPTZSTMTRB
    Expression System StrainSG62052/PGP1-2
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneMTRB
    Organism ScientificGEOBACILLUS STEAROTHERMOPHILUS
    Organism Taxid1422
    SynonymTRP RNA-BINDING ATTENUATION PROTEIN,TRAP,TRYPTOPHAN RNA- BINDING ATTENUATOR PROTEIN
 
Molecule 2 - (GAGUU)10GAG 53-NUCLEOTIDE RNA
    ChainsW
    EngineeredYES
    Fragment(GAGUU)10GAG 53-NUCLEOTIDE RNA
    Organism ScientificSYNTHETIC CONSTRUCT
    Organism Taxid32630
    Other DetailsSYNTHETIC RNA. IN-VITRO TRANSCRIPTION
    SyntheticYES

 Structural Features

(-) Chains, Units

  1234567891011121314151617181920212223
Asymmetric Unit ABCDEFGHIJKLMNOPQRSTUVW
Biological Unit 1 (1x)ABCDEFGHIJK            
Biological Unit 2 (1x)           LMNOPQRSTUVW

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 22)

Asymmetric Unit (1, 22)
No.NameCountTypeFull Name
1TRP22Ligand/IonTRYPTOPHAN
Biological Unit 1 (1, 11)
No.NameCountTypeFull Name
1TRP11Ligand/IonTRYPTOPHAN
Biological Unit 2 (1, 11)
No.NameCountTypeFull Name
1TRP11Ligand/IonTRYPTOPHAN

(-) Sites  (22, 22)

Asymmetric Unit (22, 22)
No.NameEvidenceResiduesDescription
01AC1SOFTWARETHR A:25 , ARG A:26 , GLY A:27 , ASP A:29 , THR A:30 , SER A:53 , GLY B:23 , ALA B:46 , GLN B:47 , THR B:49 , THR B:52 , HOH B:212binding site for residue TRP A 101
02AC2SOFTWARETHR B:25 , ARG B:26 , GLY B:27 , ASP B:29 , THR B:30 , SER B:53 , GLY C:23 , GLN C:47 , THR C:49 , THR C:52 , HOH C:215binding site for residue TRP B 101
03AC3SOFTWARETHR C:25 , ARG C:26 , GLY C:27 , ASP C:29 , THR C:30 , SER C:53 , GLY D:23 , GLN D:47 , THR D:49 , THR D:52 , HOH D:220binding site for residue TRP C 101
04AC4SOFTWARETHR D:25 , ARG D:26 , GLY D:27 , ASP D:29 , THR D:30 , SER D:53 , GLY E:23 , GLN E:47 , THR E:49 , THR E:52 , HOH E:219binding site for residue TRP D 101
05AC5SOFTWARETHR E:25 , ARG E:26 , GLY E:27 , ASP E:29 , THR E:30 , SER E:53 , HOH E:222 , GLY F:23 , GLN F:47 , THR F:49 , THR F:52binding site for residue TRP E 101
06AC6SOFTWARETHR F:25 , GLY F:27 , ASP F:29 , THR F:30 , SER F:53 , HOH F:227 , GLY G:23 , GLN G:47 , THR G:49 , THR G:52binding site for residue TRP F 101
07AC7SOFTWARETHR G:25 , ARG G:26 , GLY G:27 , ASP G:29 , THR G:30 , SER G:53 , GLY H:23 , GLN H:47 , THR H:49 , THR H:52 , HOH H:218binding site for residue TRP G 101
08AC8SOFTWARETHR H:25 , ARG H:26 , GLY H:27 , ASP H:29 , THR H:30 , SER H:53 , GLY I:23 , GLN I:47 , THR I:49 , THR I:52 , HOH I:206binding site for residue TRP H 101
09AC9SOFTWARETHR I:25 , ARG I:26 , GLY I:27 , ASP I:29 , THR I:30 , SER I:53 , GLY J:23 , GLN J:47 , THR J:49 , THR J:52 , HOH J:209binding site for residue TRP I 101
10AD1SOFTWARETHR J:25 , ARG J:26 , GLY J:27 , ASP J:29 , THR J:30 , SER J:53 , GLY K:23 , GLN K:47 , THR K:49 , THR K:52 , HOH K:214binding site for residue TRP J 101
11AD2SOFTWAREGLY A:23 , GLN A:47 , THR A:49 , THR A:52 , HOH A:222 , THR K:25 , ARG K:26 , GLY K:27 , ASP K:29 , THR K:30 , SER K:53binding site for residue TRP K 101
12AD3SOFTWARETHR L:25 , ARG L:26 , GLY L:27 , ASP L:29 , THR L:30 , SER L:53 , GLY V:23 , GLN V:47 , THR V:49 , THR V:52binding site for residue TRP L 101
13AD4SOFTWAREGLY L:23 , HIS L:33 , GLN L:47 , THR L:49 , THR L:52 , HOH L:213 , THR M:25 , ARG M:26 , GLY M:27 , ASP M:29 , THR M:30 , SER M:53binding site for residue TRP M 101
14AD5SOFTWAREGLY M:23 , GLN M:47 , THR M:49 , THR M:52 , HOH M:221 , THR N:25 , ARG N:26 , GLY N:27 , ASP N:29 , THR N:30 , SER N:53binding site for residue TRP N 101
15AD6SOFTWAREGLY N:23 , GLN N:47 , THR N:49 , THR N:52 , HOH N:218 , THR O:25 , ARG O:26 , GLY O:27 , ASP O:29 , THR O:30 , SER O:53binding site for residue TRP O 101
16AD7SOFTWAREGLY O:23 , GLN O:47 , THR O:49 , THR O:52 , HOH O:221 , THR P:25 , ARG P:26 , GLY P:27 , ASP P:29 , THR P:30 , SER P:53binding site for residue TRP P 101
17AD8SOFTWAREGLY P:23 , GLN P:47 , THR P:49 , THR P:52 , HOH P:220 , THR Q:25 , ARG Q:26 , GLY Q:27 , ASP Q:29 , THR Q:30 , SER Q:53binding site for residue TRP Q 101
18AD9SOFTWAREGLY Q:23 , GLN Q:47 , THR Q:49 , THR Q:52 , THR R:25 , ARG R:26 , GLY R:27 , ASP R:29 , THR R:30 , SER R:53 , HOH R:221binding site for residue TRP R 101
19AE1SOFTWAREGLY R:23 , GLN R:47 , THR R:49 , THR R:52 , HOH R:213 , THR S:25 , ARG S:26 , GLY S:27 , ASP S:29 , THR S:30 , SER S:53binding site for residue TRP S 101
20AE2SOFTWAREGLY S:23 , ALA S:46 , GLN S:47 , THR S:49 , THR S:52 , HOH S:204 , THR T:25 , ARG T:26 , GLY T:27 , ASP T:29 , THR T:30 , SER T:53binding site for residue TRP T 101
21AE3SOFTWAREGLY T:23 , GLN T:47 , THR T:49 , THR T:52 , HOH T:221 , THR U:25 , ARG U:26 , GLY U:27 , ASP U:29 , THR U:30 , SER U:53binding site for residue TRP U 101
22AE4SOFTWAREGLY U:23 , GLN U:47 , THR U:49 , THR U:52 , THR V:25 , ARG V:26 , GLY V:27 , ASP V:29 , THR V:30 , SER V:53 , HOH V:210binding site for residue TRP V 101

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5EEV)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5EEV)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5EEV)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5EEV)

(-) Exons   (0, 0)

(no "Exon" information available for 5EEV)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:69
                                                                                                     
               SCOP domains --------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------- Transcript
                 5eev A   6 NSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    15        25        35        45        55        65         

Chain B from PDB  Type:PROTEIN  Length:68
                                                                                                    
               SCOP domains -------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------- Transcript
                 5eev B   7 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    16        26        36        46        56        66        

Chain C from PDB  Type:PROTEIN  Length:69
                                                                                                     
               SCOP domains --------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------- Transcript
                 5eev C   6 NSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    15        25        35        45        55        65         

Chain D from PDB  Type:PROTEIN  Length:69
                                                                                                     
               SCOP domains --------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------- Transcript
                 5eev D   7 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGK  75
                                    16        26        36        46        56        66         

Chain E from PDB  Type:PROTEIN  Length:68
                                                                                                    
               SCOP domains -------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------- Transcript
                 5eev E   7 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    16        26        36        46        56        66        

Chain F from PDB  Type:PROTEIN  Length:69
                                                                                                     
               SCOP domains --------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------- Transcript
                 5eev F   7 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGK  75
                                    16        26        36        46        56        66         

Chain G from PDB  Type:PROTEIN  Length:68
                                                                                                    
               SCOP domains -------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....eeeeeee........eeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------- Transcript
                 5eev G   7 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    16        26        36        46        56        66        

Chain H from PDB  Type:PROTEIN  Length:68
                                                                                                    
               SCOP domains -------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------- Transcript
                 5eev H   7 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    16        26        36        46        56        66        

Chain I from PDB  Type:PROTEIN  Length:68
                                                                                                    
               SCOP domains -------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------- Transcript
                 5eev I   7 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    16        26        36        46        56        66        

Chain J from PDB  Type:PROTEIN  Length:67
                                                                                                   
               SCOP domains ------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------- Transcript
                 5eev J   7 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESE  73
                                    16        26        36        46        56        66       

Chain K from PDB  Type:PROTEIN  Length:68
                                                                                                    
               SCOP domains -------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------- Transcript
                 5eev K   7 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    16        26        36        46        56        66        

Chain L from PDB  Type:PROTEIN  Length:70
                                                                                                      
               SCOP domains ---------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                 5eev L   5 TNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    14        24        34        44        54        64        74

Chain M from PDB  Type:PROTEIN  Length:70
                                                                                                      
               SCOP domains ---------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                 5eev M   5 TNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    14        24        34        44        54        64        74

Chain N from PDB  Type:PROTEIN  Length:70
                                                                                                      
               SCOP domains ---------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                 5eev N   5 TNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    14        24        34        44        54        64        74

Chain O from PDB  Type:PROTEIN  Length:70
                                                                                                      
               SCOP domains ---------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                 5eev O   5 TNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    14        24        34        44        54        64        74

Chain P from PDB  Type:PROTEIN  Length:70
                                                                                                      
               SCOP domains ---------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                 5eev P   5 TNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    14        24        34        44        54        64        74

Chain Q from PDB  Type:PROTEIN  Length:70
                                                                                                      
               SCOP domains ---------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                 5eev Q   5 TNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    14        24        34        44        54        64        74

Chain R from PDB  Type:PROTEIN  Length:70
                                                                                                      
               SCOP domains ---------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                 5eev R   5 TNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    14        24        34        44        54        64        74

Chain S from PDB  Type:PROTEIN  Length:70
                                                                                                      
               SCOP domains ---------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                 5eev S   5 TNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    14        24        34        44        54        64        74

Chain T from PDB  Type:PROTEIN  Length:70
                                                                                                      
               SCOP domains ---------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                 5eev T   5 TNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    14        24        34        44        54        64        74

Chain U from PDB  Type:PROTEIN  Length:70
                                                                                                      
               SCOP domains ---------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                 5eev U   5 TNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    14        24        34        44        54        64        74

Chain V from PDB  Type:PROTEIN  Length:70
                                                                                                      
               SCOP domains ---------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee....eeeeeee......eeeeeee....eeeee....eeeeeee..eeeee..eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                 5eev V   5 TNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG  74
                                    14        24        34        44        54        64        74

Chain W from PDB  Type:RNA  Length:44
                                                                            
                 5eev W 101 GAGUGAGUGAGUGAGUGAGUGAGUGAGUGAGUGAGUGAGUGAGU 154
                               ||  112 ||  ||124|  ||  137 ||  ||149|   
                             104|  ||  ||  || 126  ||  ||  ||  || 151   
                              106  ||  ||  ||  | 129|  ||  ||  ||  |    
                                 109|  ||  ||  |  131  ||  ||  ||  |    
                                  111  ||  ||  |     134|  ||  ||  |    
                                     114|  ||  |      136  ||  ||  |    
                                      116  ||  |         139|  ||  |    
                                         119|  |          141  ||  |    
                                          121  |             144|  |    
                                             124              146  |    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5EEV)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5EEV)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5EEV)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    TRP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5eev)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5eev
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MTRB_GEOSE | Q9X6J6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MTRB_GEOSE | Q9X6J6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MTRB_GEOSE | Q9X6J61c9s 1gtf 1gtn 1qaw 1utd 2exs 2ext 2zcz 2zd0 2zp8 2zp9 3aqd 3zzs 4v4f 5eeu 5eew 5eex 5eey 5eez 5ef0 5ef1 5ef2 5ef3

(-) Related Entries Specified in the PDB File

1gtf 1GTF CONTAINS THE SAME PROTEIN-RNA COMPLEX. IT WAS USED AS A MOLECULAR REPLACEMENT SEARCH MODEL FOR THE CURRENT RADIATION DAMAGE INVESTIGATION.
5eeu 5EEU IS THE EXACT SAME PROTEIN-RNA CRYSTAL STRUCTURE, BUT AT LOWER DOSE (1.31MGY) WITHIN THE CURRENT RADIATION DAMAGE SERIES INVESTIGATION