Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF EPOXYQUEUOSINE REDUCTASE WITH CLEAVED RNA STEM LOOP
 
Authors :  D. P. Dowling, Z. D. Miles, C. Kohrer, V. Bandarian, C. L. Drennan
Date :  03 Aug 15  (Deposition) - 28 Sep 16  (Release) - 14 Dec 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,F  (1x)
Biol. Unit 2:  B,E  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  B12, Trna Modification, Heat-Domain, Queuosine, Oxidoreductase-Rna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. P. Dowling, Z. D. Miles, C. Kohrer, S. J. Maiocco, S. J. Elliott, V. Bandarian, C. L. Drennan
Molecular Basis Of Cobalamin-Dependent Rna Modification.
Nucleic Acids Res. V. 44 9965 2016
PubMed-ID: 27638883  |  Reference-DOI: 10.1093/NAR/GKW806

(-) Compounds

Molecule 1 - EPOXYQUEUOSINE REDUCTASE
    ChainsA, B, C, D
    EC Number1.17.99.6
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPASK-IBA43PLUS
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneQUEG, YGAP, YHBA, BSU08910
    Organism ScientificBACILLUS SUBTILIS (STRAIN 168)
    Organism Taxid224308
    Strain168
    SynonymQUEUOSINE BIOSYNTHESIS PROTEIN QUEG
 
Molecule 2 - RNA (5'- R(*G*CP*AP*GP*AP*CP*UP*GP*UP*AP*AP*AP*UP*CP*UP*GP*C)-3')
    ChainsE, F
    EngineeredYES
    Organism ScientificESCHERICHIA COLI
    Organism Taxid562
    Other DetailsSYNTHESIZED BY IDT
    SyntheticYES

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit ABCDEF
Biological Unit 1 (1x)A    F
Biological Unit 2 (1x) B  E 
Biological Unit 3 (1x)  C   
Biological Unit 4 (1x)   D  

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 20)

Asymmetric Unit (4, 20)
No.NameCountTypeFull Name
1B124Ligand/IonCOBALAMIN
2GOL4Ligand/IonGLYCEROL
3PO44Ligand/IonPHOSPHATE ION
4SF48Ligand/IonIRON/SULFUR CLUSTER
Biological Unit 1 (4, 5)
No.NameCountTypeFull Name
1B121Ligand/IonCOBALAMIN
2GOL1Ligand/IonGLYCEROL
3PO41Ligand/IonPHOSPHATE ION
4SF42Ligand/IonIRON/SULFUR CLUSTER
Biological Unit 2 (4, 5)
No.NameCountTypeFull Name
1B121Ligand/IonCOBALAMIN
2GOL1Ligand/IonGLYCEROL
3PO41Ligand/IonPHOSPHATE ION
4SF42Ligand/IonIRON/SULFUR CLUSTER
Biological Unit 3 (4, 5)
No.NameCountTypeFull Name
1B121Ligand/IonCOBALAMIN
2GOL1Ligand/IonGLYCEROL
3PO41Ligand/IonPHOSPHATE ION
4SF42Ligand/IonIRON/SULFUR CLUSTER
Biological Unit 4 (4, 5)
No.NameCountTypeFull Name
1B121Ligand/IonCOBALAMIN
2GOL1Ligand/IonGLYCEROL
3PO41Ligand/IonPHOSPHATE ION
4SF42Ligand/IonIRON/SULFUR CLUSTER

(-) Sites  (20, 20)

Asymmetric Unit (20, 20)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREALA A:153 , LYS A:154 , ASN A:155 , CYS A:188 , CYS A:191 , CYS A:194 , CYS A:247 , LEU A:249binding site for residue SF4 A 501
02AC2SOFTWARECYS A:198 , PRO A:199 , LEU A:209 , CYS A:214 , ILE A:215 , CYS A:240 , THR A:242 , CYS A:243binding site for residue SF4 A 502
03AC3SOFTWARESER A:32 , LEU A:33 , ARG A:36 , SER A:47 , PHE A:49 , GLU A:50 , ARG A:57 , CYS A:97 , ASP A:134 , LEU A:138 , SER A:139 , ASP A:140 , ARG A:141 , ALA A:142 , SER A:152 , ASN A:155 , CYS A:156 , MET A:157 , ILE A:158 , SER A:165 , VAL A:167 , LEU A:169 , PRO A:206 , LEU A:209 , SER A:216 , PHE A:217 , GLY A:239 , CYS A:240 , ASP A:241 , CYS A:243 , GLN A:244 , HOH A:630 , HOH A:632 , HOH A:635 , HOH A:652 , HOH A:683 , HOH A:692 , HOH A:747binding site for residue B12 A 503
04AC4SOFTWAREPHE A:49 , ASP A:134 , GLN A:220 , TYR A:238 , TRP A:294 , HOH A:652 , HOH A:653binding site for residue GOL A 504
05AC5SOFTWARELYS A:112 , HIS A:258 , PRO A:259 , GLU A:260 , HOH A:639 , HOH A:682binding site for residue PO4 A 505
06AC6SOFTWAREALA B:153 , LYS B:154 , ASN B:155 , CYS B:188 , CYS B:191 , CYS B:194 , CYS B:247binding site for residue SF4 B 501
07AC7SOFTWARECYS B:198 , LEU B:203 , LEU B:209 , CYS B:214 , ILE B:215 , CYS B:240 , THR B:242 , CYS B:243binding site for residue SF4 B 502
08AC8SOFTWARESER B:32 , LEU B:33 , ARG B:36 , SER B:47 , GLU B:50 , ARG B:57 , CYS B:97 , ASP B:134 , LEU B:138 , SER B:139 , ASP B:140 , ARG B:141 , SER B:152 , ASN B:155 , CYS B:156 , MET B:157 , ILE B:158 , SER B:165 , VAL B:167 , LEU B:169 , PRO B:206 , GLY B:207 , LEU B:209 , SER B:216 , GLY B:239 , CYS B:240 , ASP B:241 , CYS B:243 , GLN B:244 , HOH B:616 , HOH B:628 , HOH B:640 , HOH B:643 , HOH B:668 , HOH B:677binding site for residue B12 B 503
09AC9SOFTWAREASP B:134 , GLN B:220 , TYR B:238 , TRP B:294 , HOH B:657 , HOH B:677binding site for residue GOL B 504
10AD1SOFTWARELYS B:112 , HIS B:258 , PRO B:259 , GLU B:260binding site for residue PO4 B 505
11AD2SOFTWAREALA C:153 , LYS C:154 , ASN C:155 , CYS C:188 , CYS C:191 , CYS C:194 , CYS C:247binding site for residue SF4 C 501
12AD3SOFTWARECYS C:198 , LEU C:209 , CYS C:214 , ILE C:215 , CYS C:240 , THR C:242 , CYS C:243binding site for residue SF4 C 502
13AD4SOFTWARESER C:32 , LEU C:33 , ARG C:36 , SER C:47 , PHE C:49 , GLU C:50 , ARG C:57 , CYS C:97 , ASP C:134 , LEU C:138 , SER C:139 , ASP C:140 , ARG C:141 , GLU C:145 , SER C:152 , ASN C:155 , CYS C:156 , MET C:157 , ILE C:158 , SER C:165 , VAL C:167 , LEU C:169 , PRO C:206 , GLY C:207 , LEU C:209 , SER C:216 , PHE C:217 , GLY C:239 , CYS C:240 , ASP C:241 , CYS C:243 , GLN C:244 , HOH C:642 , HOH C:648 , HOH C:657 , HOH C:673 , HOH C:678 , HOH C:692binding site for residue B12 C 503
14AD5SOFTWAREPHE C:49 , ASP C:134 , GLN C:220 , TYR C:238 , TRP C:294 , HOH C:653 , HOH C:678binding site for residue GOL C 504
15AD6SOFTWARELYS C:112 , HIS C:258 , PRO C:259 , GLU C:260binding site for residue PO4 C 505
16AD7SOFTWAREALA D:153 , LYS D:154 , ASN D:155 , CYS D:188 , CYS D:191 , CYS D:194 , CYS D:247 , LEU D:249binding site for residue SF4 D 501
17AD8SOFTWARECYS D:198 , LEU D:209 , CYS D:214 , ILE D:215 , CYS D:240 , CYS D:243binding site for residue SF4 D 502
18AD9SOFTWARESER D:32 , LEU D:33 , ARG D:36 , SER D:47 , GLU D:50 , ARG D:57 , CYS D:97 , ASP D:134 , LEU D:138 , SER D:139 , ASP D:140 , ARG D:141 , ALA D:142 , SER D:152 , ASN D:155 , CYS D:156 , ILE D:158 , SER D:165 , VAL D:167 , LEU D:169 , PRO D:206 , GLY D:207 , LEU D:209 , SER D:216 , GLY D:239 , CYS D:240 , ASP D:241 , CYS D:243 , GLN D:244 , HOH D:614 , HOH D:648 , HOH D:655 , HOH D:666 , HOH D:678 , HOH D:693 , HOH D:744binding site for residue B12 D 503
19AE1SOFTWAREPHE D:49 , ASP D:134 , GLN D:220 , TYR D:238 , TRP D:294 , HOH D:628 , HOH D:693binding site for residue GOL D 504
20AE2SOFTWARELYS D:112 , HIS D:258 , PRO D:259 , GLU D:260 , HOH D:659binding site for residue PO4 D 505

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5D0A)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5D0A)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5D0A)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5D0A)

(-) Exons   (0, 0)

(no "Exon" information available for 5D0A)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:379
                                                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhh...eeeeee...hhhhhhhhhhhhhh.........hhhhhhhhhhhh....eeeeeeee..................ee.hhhh..hhhhhhhhhhhhhhhhhhh.....eeee......hhhhhhhhh...ee.....ee.......eeeeeeee.................hhhhhhh....eee..ee.hhhhhhhhhh.....hhhhhh....eee..hhhhhhhhhhh......hhhhh.hhhhhh.hhhhhh..hhhhhhhhhh.hhhhh.hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5d0a A   2 NVYQLKEELIEYAKSIGVDKIGFTTADTFDSLKDRLILQESLGYLSGFEEPDIEKRVTPKLLLPKAKSIVAIALAYPSRMKDAPRSTRTERRGIFCRASWGKDYHDVLREKLDLLEDFLKSKHDIRTKSMVDTGELSDRAVAERAGIGFSAKNCMITTPEYGSYVYLAEMITNIPFEPDVPIEDMCGSCTKCLDACPTGALVNPGQLNAQRCISFLTQTKGFLPDEFRTKIGNRLYGCDTCQTVCPLNKGKDFHLHPEMEPDPEIAKPLLKPLLAISNREFKEKFGHVSGSWRGKKPIQRNAILALAHFKDASALPELTELMHKDPRPVIRGTAAWAIGKIGDPAYAEELEKALEKEKDEEAKLEIEKGIELLKASGMT 381
                                    11        21        31        41        51        61        71        81        91       101       111       121  ||   132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372         
                                                                                                                                                    124|                                                                                                                                                                                                                                                               
                                                                                                                                                     126                                                                                                                                                                                                                                                               

Chain B from PDB  Type:PROTEIN  Length:379
                                                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhh...eeeeee...hhhhhhhhhhhhhhh........hhhhhhhhhhhh....eeeeeeee..................ee.hhhh..hhhhhhhhhhhhhhhhhhh.....eeee......hhhhhhhhh...ee.....ee.......eeeeeeee.................hhhhhhh....eee..ee.hhhhhhhhhh.....hhhhhh....eee..hhhhhhhhhhh......hhhhh.hhhhhh.hhhhhh..hhhhhhhhhh.hhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5d0a B   2 NVYQLKEELIEYAKSIGVDKIGFTTADTFDSLKDRLILQESLGYLSGFEEPDIEKRVTPKLLLPKAKSIVAIALAYPSRMKDAPRSTRTERRGIFCRASWGKDYHDVLREKLDLLEDFLKSKHDIRTKSMVDTGELSDRAVAERAGIGFSAKNCMITTPEYGSYVYLAEMITNIPFEPDVPIEDMCGSCTKCLDACPTGALVNPGQLNAQRCISFLTQTKGFLPDEFRTKIGNRLYGCDTCQTVCPLNKGKDFHLHPEMEPDPEIAKPLLKPLLAISNREFKEKFGHVSGSWRGKKPIQRNAILALAHFKDASALPELTELMHKDPRPVIRGTAAWAIGKIGDPAYAEELEKALEKEKDEEAKLEIEKGIELLKASGMT 381
                                    11        21        31        41        51        61        71        81        91       101       111       121  ||   132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372         
                                                                                                                                                    124|                                                                                                                                                                                                                                                               
                                                                                                                                                     126                                                                                                                                                                                                                                                               

Chain C from PDB  Type:PROTEIN  Length:376
                                                                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhh...eeeeee...hhhhhhhhhhhhhh.........hhhhhhhhhhhh....eeeeeeee..................ee.hhhh..hhhhhhhhhhhhhhhhhhh.....eeee......hhhhhhhhh...ee.....ee.......eeeeeeee.................hhhhhhh....eee..ee.hhhhhhhhhh.....hhhhh.....eee..hhhhhhhhhhh......hhhhh.hhhhhh..hhhhhh.hhhhhhhhhh.hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5d0a C   2 NVYQLKEELIEYAKSIGVDKIGFTTADTFDSLKDRLILQESLGYLSGFEEPDIEKRVTPKLLLPKAKSIVAIALAYPSRMKDAPRSTRTERRGIFCRASWGKDYHDVLREKLDLLEDFLKSKHDIRTKSMVDTGELSDRAVAERAGIGFSAKNCMITTPEYGSYVYLAEMITNIPFEPDVPIEDMCGSCTKCLDACPTGALVNPGQLNAQRCISFLTQTKGFLPDEFRTKIGNRLYGCDTCQTVCPLNKGKDFHLHPEMEPDPEIAKPLLKPLLAISNREFKEKFGHVSGSWRGKKPIQRNAILALAHFKDASALPELTELMHKDPRPVIRGTAAWAIGKIGDPAYAEELEKALEKEKDEEAKLEIEKGIELLKAS 378
                                    11        21        31        41        51        61        71        81        91       101       111       121  ||   132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372      
                                                                                                                                                    124|                                                                                                                                                                                                                                                            
                                                                                                                                                     126                                                                                                                                                                                                                                                            

Chain D from PDB  Type:PROTEIN  Length:375
                                                                                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhh...eeeeee...hhhhhhhhhhhhhh.........hhhhhhhhhhhh....eeeeeeee..................ee.hhhh..hhhhhhhhhhhhhhhhhhh.....eeee......hhhhhhhhh...ee.....ee.......eeeeeeee.................hhhhhhh....eee..ee.hhhhhhhhhh.....hhhhh.....eee..hhhhhhhhhhh......hhhhh.hhhhhh.hhhhhhh.hhhhhhhhhh.hhhhh.hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5d0a D   2 NVYQLKEELIEYAKSIGVDKIGFTTADTFDSLKDRLILQESLGYLSGFEEPDIEKRVTPKLLLPKAKSIVAIALAYPSRMKDAPRSTRTERRGIFCRASWGKDYHDVLREKLDLLEDFLKSKHDIRTKSMVDTGELSDRAVAERAGIGFSAKNCMITTPEYGSYVYLAEMITNIPFEPDVPIEDMCGSCTKCLDACPTGALVNPGQLNAQRCISFLTQTKGFLPDEFRTKIGNRLYGCDTCQTVCPLNKGKDFHLHPEMEPDPEIAKPLLKPLLAISNREFKEKFGHVSGSWRGKKPIQRNAILALAHFKDASALPELTELMHKDPRPVIRGTAAWAIGKIGDPAYAEELEKALEKEKDEEAKLEIEKGIELLKA 377
                                    11        21        31        41        51        61        71        81        91       101       111       121  ||   132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372     
                                                                                                                                                    124|                                                                                                                                                                                                                                                           
                                                                                                                                                     126                                                                                                                                                                                                                                                           

Chain E from PDB  Type:DNA/RNA  Length:12
                                            
                 5d0a E  28 CAGACUAAUCUG  42
                                 || 40  
                                33|     
                                 37     

Chain F from PDB  Type:DNA/RNA  Length:14
                                              
                 5d0a F  27 GCAGACUAAUCUGC  43
                                  ||39    
                                 33|      
                                  37      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5D0A)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5D0A)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5D0A)

(-) Gene Ontology  (9, 9)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    B12  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SF4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5d0a)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5d0a
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  QUEG_BACSU | P97030
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.17.99.6
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  QUEG_BACSU | P97030
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        QUEG_BACSU | P970305d08 5d0b 5t8y

(-) Related Entries Specified in the PDB File

5d08 5D08 IS THE SAME PROTEIN, SELENOMETHIONINE LABELED, WITHOUT RNA SUBSTRATE.
5d0b