Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF GALB, THE 4-CARBOXY-2-HYDROXYMUCONATE HYDRATASE, FROM PSEUODOMONAS PUTIDA KT2440
 
Authors :  S. Mazurkewich, A. S. Brott, M. S. Kimber, S. Y. K. Seah
Date :  09 Jul 15  (Deposition) - 17 Feb 16  (Release) - 13 Apr 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (6x)
Biol. Unit 2:  B  (6x)
Keywords :  Galb, Hydratase, Metalloenzyme, Rossmann Fold, Helical Hairpin, Gallic Acid, Hexamer, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Mazurkewich, A. S. Brott, M. S. Kimber, S. Y. Seah
Structural And Kinetic Characterization Of The 4-Carboxy-2-Hydroxymuconate Hydratase From The Gallate And Protocatechuate 4, 5-Cleavage Pathways Of Pseudomonas Putida Kt2440.
J. Biol. Chem. V. 291 7669 2016
PubMed-ID: 26867578  |  Reference-DOI: 10.1074/JBC.M115.682054

(-) Compounds

Molecule 1 - 4-OXALMESACONATE HYDRATASE
    Chains: A, B
    EC Number: 4.2.1.83
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PT7-7
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 20-258
    Gene: GALB, PP_2515
    Organism Scientific: PSEUDOMONAS PUTIDA (STRAIN KT2440)
    Organism Taxid: 160488
    Strain: KT2440
    Synonym: OMA HYDRATASE,GALLATE DEGRADATION PROTEIN B

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (6x): A 
Biological Unit 2 (6x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 18)

Asymmetric Unit (2, 18)
No.NameCountTypeFull Name
1GOL16Ligand/IonGLYCEROL
2ZN2Ligand/IonZINC ION
Biological Unit 1 (1, 54)
No.NameCountTypeFull Name
1GOL54Ligand/IonGLYCEROL
2ZN-1Ligand/IonZINC ION
Biological Unit 2 (1, 42)
No.NameCountTypeFull Name
1GOL42Ligand/IonGLYCEROL
2ZN-1Ligand/IonZINC ION

(-) Sites  (18, 18)

Asymmetric Unit (18, 18)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:14 , ASP A:17 , GLU A:48 , HIS A:127 , HOH A:401binding site for residue ZN A 301
02AC2SOFTWARELEU A:119 , LYS A:120 , ASP A:121 , TYR A:125 , HOH A:411 , HOH A:467 , HOH A:525 , HOH A:574binding site for residue GOL A 302
03AC3SOFTWARETRP A:183 , TYR A:187 , HOH A:414 , HOH A:560binding site for residue GOL A 303
04AC4SOFTWAREMET A:5 , SER A:7 , VAL A:109 , HOH A:403 , HOH B:450binding site for residue GOL A 304
05AC5SOFTWAREALA A:155 , ASN A:217 , VAL A:218 , ARG A:224 , ARG A:238 , VAL A:239 , ALA A:244 , HOH A:468binding site for residue GOL A 305
06AC6SOFTWARETHR A:180 , SER A:181 , VAL A:182 , TRP A:183 , ASP A:184 , GOL A:310 , HOH A:412binding site for residue GOL A 306
07AC7SOFTWAREHIS A:37 , ARG A:108 , HOH A:557binding site for residue GOL A 307
08AC8SOFTWARELYS A:64 , ASP A:86 , HOH A:424binding site for residue GOL A 308
09AC9SOFTWARELYS A:6 , TYR A:34 , ASN A:242 , HOH A:408 , HOH A:446 , HOH A:473 , GOL B:302binding site for residue GOL A 309
10AD1SOFTWARESER A:181 , ASN A:225 , GOL A:306 , HOH A:572 , LYS B:51 , GLU B:197binding site for residue GOL A 310
11AD2SOFTWAREHIS B:14 , ASP B:17 , GLU B:48 , HIS B:127 , HOH B:403binding site for residue ZN B 301
12AD3SOFTWAREGOL A:309 , TRP B:183 , TYR B:187 , GLU B:201 , HOH B:407 , HOH B:434binding site for residue GOL B 302
13AD4SOFTWARELYS B:120 , ASP B:121 , HOH B:409 , HOH B:427 , HOH B:502binding site for residue GOL B 303
14AD5SOFTWAREARG B:21 , HIS B:164 , LEU B:199 , ARG B:216 , ILE B:220 , HOH B:447binding site for residue GOL B 304
15AD6SOFTWAREHIS B:37 , ARG B:108binding site for residue GOL B 305
16AD7SOFTWAREGLN B:110 , PRO B:111 , GLU B:112 , GLY B:154 , ALA B:155 , GOL B:307 , HOH B:510 , HOH B:534binding site for residue GOL B 306
17AD8SOFTWARELYS B:151 , ILE B:152 , THR B:221 , GOL B:306 , HOH B:458binding site for residue GOL B 307
18AD9SOFTWAREGLU B:45 , LYS B:64 , ASP B:86 , HOH B:404 , HOH B:508binding site for residue GOL B 308

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5CGZ)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Tyr A:90 -Pro A:91
2Tyr B:90 -Pro B:91

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5CGZ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5CGZ)

(-) Exons   (0, 0)

(no "Exon" information available for 5CGZ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:240
                                                                                                                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeee...hhhhhhhhhhhhhhhhh..eeeeee........hhhhhhh...hhhhhhhhhhhhhhhhhhhhheeeee..........hhhhhhhhhhhhhhhh...eee........hhhhhhhhhhhhhhhhhhh..............eeee.............eeee...hhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh...........eeeeee.......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5cgz A   5 MKSALVVSAHSADFVWRAGGAIALHAEQGYAMHVVCLSFGERGESAKLWRKGEMTEAKVKDARREEAMAAAEILGASVEFFDIGDYPMRADKDTLFRLADVYRRVQPEFVLSHSLKDPYNYDHPLAMHLAQEARIIAQAEGYKPGEKIVGAPPVYAFEPHQPEQCEWRPDTFLDITSVWDKKYAAIQCMAGQEHLWEYYTRVALQRGVQAKRNVGITSARNIVYAEGLQSVFPRVTENLA 244
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244


Chain B from PDB  Type:PROTEIN  Length:240
                                                                                                                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeee...hhhhhhhhhhhhhhhhh..eeeeee........hhhhhh....hhhhhhhhhhhhhhhhhhhhheeeee..........hhhhhhhhhhhhhhhh...eee........hhhhhhhhhhhhhhhhh................eeee.............eeee...hhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh...........eeeeee.......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5cgz B   5 MKSALVVSAHSADFVWRAGGAIALHAEQGYAMHVVCLSFGERGESAKLWRKGEMTEAKVKDARREEAMAAAEILGASVEFFDIGDYPMRADKDTLFRLADVYRRVQPEFVLSHSLKDPYNYDHPLAMHLAQEARIIAQAEGYKPGEKIVGAPPVYAFEPHQPEQCEWRPDTFLDITSVWDKKYAAIQCMAGQEHLWEYYTRVALQRGVQAKRNVGITSARNIVYAEGLQSVFPRVTENLA 244
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5CGZ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5CGZ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5CGZ)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Tyr A:90 - Pro A:91   [ RasMol ]  
    Tyr B:90 - Pro B:91   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5cgz
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GALB_PSEPK | Q88JX8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.2.1.83
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GALB_PSEPK | Q88JX8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5CGZ)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5CGZ)