Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  INSULIN REGULATED AMINOPEPTIDASE
 
Authors :  A. Mpakali, E. Saridakis, K. Harlos, Y. Zhao, E. Stratikos
Date :  26 Jun 15  (Deposition) - 26 Aug 15  (Release) - 16 Sep 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.37
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Aminopeptidase, Antigen Presentation, Hydrolase, Irap (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Mpakali, E. Saridakis, K. Harlos, Y. Zhao, A. Papakyriakou, P. Kokkala, D. Georgiadis, E. Stratikos
Crystal Structure Of Insulin-Regulated Aminopeptidase With Bound Substrate Analogue Provides Insight On Antigenic Epitope Precursor Recognition And Processing.
J Immunol. V. 195 2842 2015
PubMed-ID: 26259583  |  Reference-DOI: 10.4049/JIMMUNOL.1501103

(-) Compounds

Molecule 1 - LEUCYL-CYSTINYL AMINOPEPTIDASE
    ChainsA, B
    EC Number3.4.11.3
    EngineeredYES
    Expression SystemHOMO SAPIENS
    Expression System CommonHUMAN
    Expression System Taxid9606
    GeneLNPEP, OTASE
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCYSTINYL AMINOPEPTIDASE,INSULIN-REGULATED MEMBRANE AMINOPEPTIDASE,INSULIN-RESPONSIVE AMINOPEPTIDASE,IRAP,OXYTOCINASE, OTASE,PLACENTAL LEUCINE AMINOPEPTIDASE,P-LAP

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 27)

Asymmetric Unit (2, 27)
No.NameCountTypeFull Name
1NAG25Ligand/IonN-ACETYL-D-GLUCOSAMINE
2ZN2Ligand/IonZINC ION
Biological Unit 1 (1, 13)
No.NameCountTypeFull Name
1NAG13Ligand/IonN-ACETYL-D-GLUCOSAMINE
2ZN-1Ligand/IonZINC ION
Biological Unit 2 (1, 12)
No.NameCountTypeFull Name
1NAG12Ligand/IonN-ACETYL-D-GLUCOSAMINE
2ZN-1Ligand/IonZINC ION

(-) Sites  (22, 22)

Asymmetric Unit (22, 22)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:464 , HIS A:468 , GLU A:487binding site for residue ZN A 1101
02AC2SOFTWAREASP A:591 , GLU A:595 , NAG A:1113binding site for residue NAG A 1114
03AC3SOFTWAREGLU B:431 , HIS B:464 , GLU B:465 , HIS B:468 , GLU B:487binding site for residue ZN B 1101
04AC4SOFTWAREHIS A:182 , PRO A:183 , ASN A:184 , THR A:186 , ASP A:322 , GLN A:324binding site for Poly-Saccharide residues NAG A 1102 through NAG A 1103 bound to ASN A 184
05AC5SOFTWAREASN A:215 , SER A:217 , SER A:264binding site for Mono-Saccharide NAG A 1104 bound to ASN A 215
06AC6SOFTWARELEU A:175 , GLY A:254 , ASN A:256binding site for Mono-Saccharide NAG A 1105 bound to ASN A 256
07AC7SOFTWAREGLY A:213 , ASN A:215 , SER A:264 , ALA A:265 , ASN A:266binding site for Mono-Saccharide NAG A 1106 bound to ASN A 266
08AC8SOFTWARELYS A:367 , ASN A:368 , SER A:370 , TYR A:381binding site for Poly-Saccharide residues NAG A 1107 through NAG A 1108 bound to ASN A 368
09AC9SOFTWAREASN A:374 , GLU A:402 , GLN A:411binding site for Mono-Saccharide NAG A 1112 bound to ASN A 374
10AD1SOFTWARELEU A:574 , ASN A:578 , HIS A:579 , SER A:592 , GLU A:595 , NAG A:1114binding site for Mono-Saccharide NAG A 1113 bound to ASN A 578
11AD2SOFTWAREVAL A:680 , ASN A:682binding site for Mono-Saccharide NAG A 1109 bound to ASN A 682
12AD3SOFTWARETYR A:721 , ASN A:760binding site for Mono-Saccharide NAG A 1110 bound to ASN A 760
13AD4SOFTWAREASN A:850binding site for Mono-Saccharide NAG A 1111 bound to ASN A 850
14AD5SOFTWAREHIS B:182 , PRO B:183 , ASN B:184 , ASP B:322 , GLN B:324 , LEU B:343binding site for Poly-Saccharide residues NAG B 1102 through NAG B 1103 bound to ASN B 184
15AD6SOFTWAREASN B:215 , SER B:264binding site for Mono-Saccharide NAG B 1104 bound to ASN B 215
16AD7SOFTWAREGLU A:229 , LYS A:230 , GLN A:231 , GLN B:199 , GLY B:254 , ASN B:256binding site for Poly-Saccharide residues NAG B 1105 through NAG B 1106 bound to ASN B 256
17AD8SOFTWAREGLY B:213 , ALA B:265 , ASN B:266binding site for Mono-Saccharide NAG B 1107 bound to ASN B 266
18AD9SOFTWAREASN B:368 , LEU B:369 , SER B:370binding site for Poly-Saccharide residues NAG B 1108 through NAG B 1109 bound to ASN B 368
19AE1SOFTWAREASN B:374 , GLN B:411binding site for Mono-Saccharide NAG B 1112 bound to ASN B 374
20AE2SOFTWAREASN B:578 , HIS B:579 , SER B:592binding site for Mono-Saccharide NAG B 1113 bound to ASN B 578
21AE3SOFTWAREASN B:760binding site for Mono-Saccharide NAG B 1110 bound to ASN B 760
22AE4SOFTWAREASN B:850binding site for Mono-Saccharide NAG B 1111 bound to ASN B 850

(-) SS Bonds  (1, 1)

Asymmetric Unit
No.Residues
1B:828 -B:835

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Glu A:295 -Pro A:296
2Glu B:295 -Pro B:296

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5C97)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5C97)

(-) Exons   (0, 0)

(no "Exon" information available for 5C97)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:860
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................eeeeeeeee....eeeeeeeeeee....eeeeeee......................eeeee....eeeeeeeeee....eeeeeeeeeee......eeeeeeee.....eeeeeeee....hhhhhh..........eeeeeeeee...eeee...eeeeee....eeeeee......hhhhh.eeee.....eeee..eeeeeee.hhhhhhhhhhhhhhhhhhhhhh..........eeeeeee............eeeee.hhh.......hhhhhhhhhhhhhhhhhhhhh....ee.hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh.............hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...ee.hhhhhhhhh...........hhhhhhhh...eeeeee......eeeeee.............ee..eeee.hhh.eeee..ee...eee........eeee.hhhh...eeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh......hhhhhhhhhhhhh.hhhhhhhhhhhhh.....hhhhhhhhhhhh..hhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhh...hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5c97 A  160 LFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL 1025
                                   169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579       589       599       609       619       629       639|      655       665       675       685       695       705       715       725       735       745       755       765       775       785       795       805       815       825       835       845       855       865       875       885       895       905       915       925       935       945       955       965       975       985       995      1005      1015      1025
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         639|                                                                                                                                                                                                                                                                                                                                                                                           
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          646                                                                                                                                                                                                                                                                                                                                                                                           

Chain B from PDB  Type:PROTEIN  Length:851
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eeeeeeeeeeeee....eee..eeeeeee...eeeeeee.......eeee....ee.eeeee....eeeeeeeeee....eeeeeee..........eeeeeeee.....eeeeeeee....hhhhhh..........eeeeeeeee...eeee...eeeeee....eeeeee......hhhhh.eeee..eeeeee....eeeeee.hhhh..hhhhhhhhhhhhhhhhhhh.......eeeeeee............eeeeehhhhh..........hhhhhhhhhhhhhhhhh...eee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eee.hhhhhhhhh......................eeeeee......eeeeee..........ee..eee.....eee..ee...eee.........eee.hhhh...eeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh..hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhh.......hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh............hhhhhhh.hhhhhhhhhhhhh.....hhhhhhhhhhh...hhhhhhhhhhhhhhh...hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhh...hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5c97 B  160 LFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNTSYLWHIPLSYVTENYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL 1025
                                   169       179       189       199       209       219    || 233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633    || 652       664       674       684       694       704       714       724       734       744       754       764       774       784       794       804       814       824       834       844       854       864       874       884       894       904       914       924       934       944       954       964       974       984       994      1004      1014      1024 
                                                                                          224|                                                                                                                                                                                                                                                                                                                                                                                                                      638|          661|                                                                                                                                                                                                                                                                                                                                                                         
                                                                                           229                                                                                                                                                                                                                                                                                                                                                                                                                       648           664                                                                                                                                                                                                                                                                                                                                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5C97)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5C97)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5C97)

(-) Gene Ontology  (31, 31)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:295 - Pro A:296   [ RasMol ]  
    Glu B:295 - Pro B:296   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5c97
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LCAP_HUMAN | Q9UIQ6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.11.3
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  LCAP_HUMAN | Q9UIQ6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LCAP_HUMAN | Q9UIQ64p8q 4pj6 4z7i 5jhq 5mj6

(-) Related Entries Specified in the PDB File

4p8q 4P8Q CONTAINS THE SAME PROTEIN COMPLEXED WITH ALANINE
4pj6 4PJ6 CONTAINS THE SAME PROTEIN COMPLEXED WITH LYSINE
4z7i 4Z7I CONTAINS THE SAME PROTEIN COMPLEXED WITH A PSEUDOPEPTIDIC LIGAND