Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYO-EM REVEALS THE CONFORMATION OF A SUBSTRATE ANALOGUE IN THE HUMAN 20S PROTEASOME CORE
 
Authors :  P. C. A. Da Fonseca, E. P. Morris
Date :  22 Apr 15  (Deposition) - 30 Dec 15  (Release) - 30 Dec 15  (Revision)
Method :  ELECTRON MICROSCOPY
Resolution :  3.50
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,a,b
Keywords :  Hydrolase, Proteasome, 20S, Adaahx3L3Vs, Ligand, Inhibitor, Drug Design (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  P. C. A. Da Fonseca, E. P. Morris
Cryo-Em Reveals The Conformation Of A Substrate Analogue In The Human 20S Proteasome Core.
Nat. Commun. V. 6 7573 2015
PubMed-ID: 26133119  |  Reference-DOI: 10.1038/NCOMMS8573

(-) Compounds

Molecule 1 - PROTEASOME SUBUNIT ALPHA TYPE-6
    CellERYTHROCYTES
    ChainsA, O
    EC Number3.4.25.1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Synonym27 KDA PROSOMAL PROTEIN, P27K, MACROPAIN IOTA CHAIN, MULTICATALYTIC ENDOPEPTIDASE COMPLEX IOTA CHAIN, PROTEASOME IOTA CHAIN
 
Molecule 2 - PROTEASOME SUBUNIT ALPHA TYPE-2
    CellERYTHROCYTES
    ChainsB, P
    EC Number3.4.25.1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMACROPAIN SUBUNIT C3, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT C3, PROTEASOME COMPONENT C3
 
Molecule 3 - PROTEASOME SUBUNIT ALPHA TYPE-4
    CellERYTHROCYTES
    ChainsC, Q
    EC Number3.4.25.1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMACROPAIN SUBUNIT C9, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT C9, PROTEASOME COMPONENT C9, PROTEASOME SUBUNIT L
 
Molecule 4 - PROTEASOME SUBUNIT ALPHA TYPE-7
    CellERYTHROCYTES
    ChainsD, R
    EC Number3.4.25.1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPROTEASOME SUBUNIT RC6-1, PROTEASOME SUBUNIT XAPC7
 
Molecule 5 - PROTEASOME SUBUNIT ALPHA TYPE-5
    CellERYTHROCYTES
    ChainsE, S
    EC Number3.4.25.1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMACROPAIN ZETA CHAIN, MULTICATALYTIC ENDOPEPTIDASE COMPLEX ZETA CHAIN, PROTEASOME ZETA CHAIN
 
Molecule 6 - PROTEASOME SUBUNIT ALPHA TYPE-1
    CellERYTHROCYTES
    ChainsF, T
    EC Number3.4.25.1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Synonym30 KDA PROSOMAL PROTEIN, PROS-30, MACROPAIN SUBUNIT C2, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT C2, PROTEASOME COMPONENT C2, PROTEASOME NU CHAIN
 
Molecule 7 - PROTEASOME SUBUNIT ALPHA TYPE-3
    CellERYTHROCYTES
    ChainsG, U
    EC Number3.4.25.1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMACROPAIN SUBUNIT C8, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT C8, PROTEASOME COMPONENT C8
 
Molecule 8 - PROTEASOME SUBUNIT BETA TYPE-6
    CellERYTHROCYTES
    ChainsH, V
    EC Number3.4.25.1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsSUBUNIT PARTIALLY BOUND TO THE INHIBITOR ADAMANTANE- ACETYL-(6-AMINOHEXANOYL)3-(LEUCINYL)3-VINYL-(METHYL)-SULFONE (ADAAHX3L3VS)
    SynonymMACROPAIN DELTA CHAIN, MULTICATALYTIC ENDOPEPTIDASE COMPLEX DELTA CHAIN, PROTEASOME DELTA CHAIN, PROTEASOME SUBUNIT Y
 
Molecule 9 - PROTEASOME SUBUNIT BETA TYPE-7
    CellERYTHROCYTES
    ChainsI, W
    EC Number3.4.25.1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsSUBUNIT PARTIALLY BOUND TO THE INHIBITOR ADAMANTANE- ACETYL-(6-AMINOHEXANOYL)3-(LEUCINYL)3-VINYL-(METHYL)-SULFONE (ADAAHX3L3VS)
    SynonymMACROPAIN CHAIN Z, MULTICATALYTIC ENDOPEPTIDASE COMPLEX CHAIN Z, PROTEASOME SUBUNIT Z
 
Molecule 10 - PROTEASOME SUBUNIT BETA TYPE-3
    CellERYTHROCYTES
    ChainsJ, X
    EC Number3.4.25.1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPROTEASOME CHAIN 13, PROTEASOME COMPONENT C10-II, PROTEASOME THETA CHAIN
 
Molecule 11 - PROTEASOME SUBUNIT BETA TYPE-2
    CellERYTHROCYTES
    ChainsK, Y
    EC Number3.4.25.1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMACROPAIN SUBUNIT C7-I, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT C7-I, PROTEASOME COMPONENT C7-I
 
Molecule 12 - PROTEASOME SUBUNIT BETA TYPE-5
    CellERYTHROCYTES
    ChainsL, Z
    EC Number3.4.25.1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsSUBUNIT BOUND TO THE INHIBITOR ADAMANTANE-ACETYL-(6- AMINOHEXANOYL)3-(LEUCINYL)3-VINYL-(METHYL)-SULFONE (ADAAHX3L3VS)
    SynonymMACROPAIN EPSILON CHAIN, MULTICATALYTIC ENDOPEPTIDASE COMPLEX EPSILON CHAIN, PROTEASOME CHAIN 6, PROTEASOME EPSILON CHAIN, PROTEASOME SUBUNIT MB1, PROTEASOME SUBUNIT X
 
Molecule 13 - PROTEASOME SUBUNIT BETA TYPE-1
    CellERYTHROCYTES
    ChainsM, a
    EC Number3.4.25.1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMACROPAIN SUBUNIT C5, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT C5, PROTEASOME COMPONENT C5, PROTEASOME GAMMA CHAIN
 
Molecule 14 - PROTEASOME SUBUNIT BETA TYPE-4
    CellERYTHROCYTES
    ChainsN, b
    EC Number3.4.25.1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Synonym26 KDA PROSOMAL PROTEIN, PROS-26, MACROPAIN BETA CHAIN, MULTICATALYTIC ENDOPEPTIDASE COMPLEX BETA CHAIN, PROTEASOME BETA CHAIN, PROTEASOME CHAIN 3, HSN3

 Structural Features

(-) Chains, Units

  12345678910111213141516171819202122232425262728
Asymmetric/Biological Unit ABCDEFGHIJKLMNOPQRSTUVWXYZab

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 6)

Asymmetric/Biological Unit (1, 6)
No.NameCountTypeFull Name
1KNM6Ligand/IonADA-(AHX)3-(LEU)3-VINYL SULFONE

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETHR H:1 , THR H:20 , THR H:21 , THR H:22 , LYS H:33 , ARG H:45 , GLY H:47 , SER H:48 , SER H:130 , HIS I:116 , SER I:118BINDING SITE FOR LIGAND KNM H 300 BOUND TO THR H 1
2AC2SOFTWARETHR I:1 , ALA I:20 , THR I:21 , GLU I:22 , ALA I:46 , GLY I:47 , ALA I:49 , THR I:52 , GLY I:128 , SER I:129 , ASP J:124BINDING SITE FOR LIGAND KNM I 300 BOUND TO THR I 1
3AC3SOFTWARETHR L:1 , ALA L:20 , THR L:21 , ALA L:22 , LYS L:33 , MET L:45 , GLY L:47 , ALA L:49 , ASP M:125BINDING SITE FOR LIGAND KNM L 300 BOUND TO THR L 1
4AC4SOFTWARETHR V:1 , THR V:20 , THR V:21 , THR V:22 , LYS V:33 , ARG V:45 , GLY V:47 , SER V:48 , SER V:130 , HIS W:116 , SER W:118BINDING SITE FOR LIGAND KNM V 300 BOUND TO THR V 1
5AC5SOFTWARETHR W:1 , ALA W:20 , THR W:21 , GLU W:22 , ALA W:46 , GLY W:47 , ALA W:49 , THR W:52 , GLY W:128 , SER W:129 , ASP X:124BINDING SITE FOR LIGAND KNM W 300 BOUND TO THR W 1
6AC6SOFTWARETHR Z:1 , ALA Z:20 , THR Z:21 , ALA Z:22 , LYS Z:33 , MET Z:45 , GLY Z:47 , ALA Z:49 , ASP a:125BINDING SITE FOR LIGAND KNM Z 300 BOUND TO THR Z 1

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1a:54 -a:61
2M:54 -M:61

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5A0Q)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5A0Q)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5A0Q)

(-) Exons   (0, 0)

(no "Exon" information available for 5A0Q)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:195
                                                                                                                                                                                                                                   
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhhhhhhhhhh....eeee....eeeee..eeee..eeeeee..hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh........eeeeeeeeeeeeeeeee..eeeee.........hhhhhhhhhh..hhhhhhhhhhhhh.....hhh.eee.............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q A  10 DRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTI 235
                                    19        29        39        49  ||    74        84        94       104       114       124       134       144|      157       167       177    || 197       207       217       227   ||
                                                                     52|                                                                         144|                               182|                                   231|
                                                                      68                                                                          148                                193                                    235

Chain B from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............hhhhhhhhhhh....eeee......eeee.................eeee..eeeeee..hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.........eeeeeeee..eeeeeeee..eeeee..eeee...hhhhhhhhhhh......hhhhhhhhhhhhhh...eeee............... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q B   5 YSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESNIEVGICNEAGFRRLTPTEVK 226
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194  ||   212       222    
                                                                                                                                                                                                                          197|                    
                                                                                                                                                                                                                           206                    

Chain C from PDB  Type:PROTEIN  Length:237
                                                                                                                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhh.............hhhhhhhhhhhh...eeeee....eeeeee..........eee....eeeee.....hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh..........eeeeeee..eeeeeeee..........eeee...hhhhhhhhhhh.......hhhhhhhhhhhhhhh..........eeeeeeeee..eeeeee..hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q C   2 SRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEE 244
                                    11        21        31        41        51     || 67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       
                                                                                  57|                                                                                                                                                                                    
                                                                                   64                                                                                                                                                                                    

Chain D from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhh...eeeee....eeee................eeeeee..hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhh..........eeeeeeeeeeeeeeeee..eeeee..eeee...hhhhhhhhhh...hhhhhhhhhhhhhh........................hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q D   5 RAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQCALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKE 235
                                    14        24        34        44        54|       72        82        92       102       112       122       132    || 144       154       164       174 ||    191       201       211       221       231    
                                                                            54|                                                                       137|                                 176|                                                   
                                                                             63                                                                        140                                  184                                                   

Chain E from PDB  Type:PROTEIN  Length:215
                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhh...eeeee....eeeeee...............eee....eeeeee..hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh..........eeeeeee....eeeeeee..eeeee..eeee...hhhhhhhhhhh......hhhhhhhhhhhhhhh.........eeeeee..........hhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q E  13 NTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEE 236
                                    22        32        42        52        62        72        82        92       102       112       122 ||    141       151       161       171       181       191       201       211       221       231     
                                                                                                                                         124|                                                                                                      
                                                                                                                                          134                                                                                                      

Chain F from PDB  Type:PROTEIN  Length:195
                                                                                                                                                                                                                                   
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............hhhhhhhhhhhh...eeeeee..eeeeeee..eee....eeeeee..hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhh.........eeeeee......eeeee...........eee...hhhhhhhhhh.......hhhhhhhhhhhhh..eeeeeee.....eee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q F   6 YDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHEFMECNLNELVKHGLRALRENVSIGIVGKDLEFTIY 224
                                    15        25        35        45    ||  66        76        86        96       106       116       126       136       146       156       166       178       188       209       219     
                                                                       50|                                                                                                              175|                197|               
                                                                        62                                                                                                               178                 209               

Chain G from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhhhhhhhhh...eeeee....eeeee.........eeeee..hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.........eeeeeee.....eeeeeee..eeeee..eeee......hhhhhhh.......hhhhhhhhhhhhhhh.....eee..............hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q G   8 DLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVELFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHAFELELSWVGELTNGRHEIVPKDIREEAEK 237
                                    17        27        37        47  ||    72        82        92       102       112       122       132       142       152       162       172       182       192       208       218       228         
                                                                     50|                                                                                                                                    201|                             
                                                                      66                                                                                                                                     208                             

Chain H from PDB  Type:PROTEIN  Length:183
                                                                                                                                                                                                                       
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee......eeee.........................eeeee..hhhhhh..hhhhhhhhhhhhhh.....hhhhhhhhhhhhhh......eeeeee.....eee...........eee...hhhhhhhhh........hhhhhhhhhhhhhhhhhh........eeeeee..eeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q H   1 TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQV 188
                                    10        20        30        40        50        60        70        80        90       100  ||   115       125       135       145       155       165       175       185   
                                                                                                                                103|                                                                               
                                                                                                                                 109                                                                               

Chain I from PDB  Type:PROTEIN  Length:198
                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeee..eeeeeee..eee..eeee.....eee.....eeeee..hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh.......eeeeeee....eeeeeee..eeeee..eeee..hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.......eeeeeee..eeee............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5a0q I   1 TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPYRCEKG 207
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190 ||     
                                                                                                                                                                                                                         192|     
                                                                                                                                                                                                                          202     

Chain J from PDB  Type:PROTEIN  Length:176
                                                                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee....eeeeeeeeeee..eeee.........eeeee..hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh.......eeeeeeeee...eeeeeee...eeee..................hhhhhhhhhhhhhhhhhh.......eeeeee....... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q J   6 NGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDDFVVSGTCQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITT 196
                                    15        25        35       |49        59        69        79        89        99       109       119    || 138  ||   150       160       170       180       190      
                                                                43|                                                                         124|    141|                                                    
                                                                 48                                                                          134     144                                                    

Chain K from PDB  Type:PROTEIN  Length:189
                                                                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee..eeeeeee................eee....eeeeee...hhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.......eeeeeee.....eeeeeee..eeeee..eeee..hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.......eeeeee........ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q K   3 YLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDL 191
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182         

Chain L from PDB  Type:PROTEIN  Length:192
                                                                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeee..eeeeee...eee..eeee....................hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh.........eeeee..eeeeeee..eeee..........hhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.........eeeee..eeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5a0q L   1 TTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVAD 194
                                    10        20        30        40        50        60        70        80        90       100    || 112       122       132       142       152       162       172       182       192  
                                                                                                                                  105|                                                                                      
                                                                                                                                   108                                                                                      

Chain M from PDB  Type:PROTEIN  Length:190
                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeeee..eee..eeee.....eee.....eeeee..hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh........eeeee.......................eeee...hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.......eeeeeee..eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q M   8 NGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIRE 205
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147      |165       175       185       195       205
                                                                                                                                                                            154|                                          
                                                                                                                                                                             163                                          

Chain N from PDB  Type:PROTEIN  Length:184
                                                                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeee..eeeeee.................eeeee..eeeeee..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh......eeeeeeee..eeeeeeee..eeeee..eee.......hhhhhhhhhhh......hhhhhhhhhhhh......eeeee........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q N   4 PMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVSYNRFQIATVTEKGVEIE 200
                                    13        23        33        43        53        63        73   ||   89        99       109       119       129       139       149       159       169     ||186       196    
                                                                                                    77|                                                                                        175|                 
                                                                                                     84                                                                                         183                 

Chain O from PDB  Type:PROTEIN  Length:195
                                                                                                                                                                                                                                   
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhhhhhhhhhh....eeee....eeeee..eeee..eeeeee..hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh........eeeeeeeeeeeeeeeee..eeeee.........hhhhhhhhhh..hhhhhhhhhhhhh.....hhh.eee.............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q O  10 DRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTI 235
                                    19        29        39        49  ||    74        84        94       104       114       124       134       144|      157       167       177    || 197       207       217       227   ||
                                                                     52|                                                                         144|                               182|                                   231|
                                                                      68                                                                          148                                193                                    235

Chain P from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............hhhhhhhhhhh....eeee......eeee.................eeee..eeeeee..hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.........eeeeeeee..eeeeeeee..eeeee..eeee...hhhhhhhhhhh......hhhhhhhhhhhhhh...eeee............... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q P   5 YSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESNIEVGICNEAGFRRLTPTEVK 226
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194  ||   212       222    
                                                                                                                                                                                                                          197|                    
                                                                                                                                                                                                                           206                    

Chain Q from PDB  Type:PROTEIN  Length:237
                                                                                                                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhh.............hhhhhhhhhhhh...eeeee....eeeeee..........eee....eeeee.....hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh..........eeeeeee..eeeeeeee..........eeee...hhhhhhhhhhh.......hhhhhhhhhhhhhhh..........eeeeeeeee..eeeeee..hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q Q   2 SRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEE 244
                                    11        21        31        41        51     || 67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       
                                                                                  57|                                                                                                                                                                                    
                                                                                   64                                                                                                                                                                                    

Chain R from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhh...eeeee....eeee................eeeeee..hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhh..........eeeeeeeeeeeeeeeee..eeeee..eeee...hhhhhhhhhh...hhhhhhhhhhhhhh........................hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q R   5 RAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQCALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKE 235
                                    14        24        34        44        54|       72        82        92       102       112       122       132    || 144       154       164       174 ||    191       201       211       221       231    
                                                                            54|                                                                       137|                                 176|                                                   
                                                                             63                                                                        140                                  184                                                   

Chain S from PDB  Type:PROTEIN  Length:215
                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhh...eeeee....eeeeee...............eee....eeeeee..hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh..........eeeeeee....eeeeeee..eeeee..eeee...hhhhhhhhhhh......hhhhhhhhhhhhhhh.........eeeeee..........hhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q S  13 NTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEE 236
                                    22        32        42        52        62        72        82        92       102       112       122 ||    141       151       161       171       181       191       201       211       221       231     
                                                                                                                                         124|                                                                                                      
                                                                                                                                          134                                                                                                      

Chain T from PDB  Type:PROTEIN  Length:195
                                                                                                                                                                                                                                   
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............hhhhhhhhhhhh...eeeeee..eeeeeee..eee....eeeeee..hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhh.........eeeeee......eeeee...........eee...hhhhhhhhhh.......hhhhhhhhhhhhh..eeeeeee.....eee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q T   6 YDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHEFMECNLNELVKHGLRALRENVSIGIVGKDLEFTIY 224
                                    15        25        35        45    ||  66        76        86        96       106       116       126       136       146       156       166       178       188       209       219     
                                                                       50|                                                                                                              175|                197|               
                                                                        62                                                                                                               178                 209               

Chain U from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhhhhhhhhh...eeeee....eeeee.........eeeee..hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.........eeeeeee.....eeeeeee..eeeee..eeee......hhhhhhh.......hhhhhhhhhhhhhhh.....eee..............hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q U   8 DLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVELFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHAFELELSWVGELTNGRHEIVPKDIREEAEK 237
                                    17        27        37        47  ||    72        82        92       102       112       122       132       142       152       162       172       182       192       208       218       228         
                                                                     50|                                                                                                                                    201|                             
                                                                      66                                                                                                                                     208                             

Chain V from PDB  Type:PROTEIN  Length:183
                                                                                                                                                                                                                       
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee......eeee.........................eeeee..hhhhhh..hhhhhhhhhhhhhh.....hhhhhhhhhhhhhh......eeeeee.....eee...........eee...hhhhhhhhh........hhhhhhhhhhhhhhhhhh........eeeeee..eeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q V   1 TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQV 188
                                    10        20        30        40        50        60        70        80        90       100  ||   115       125       135       145       155       165       175       185   
                                                                                                                                103|                                                                               
                                                                                                                                 109                                                                               

Chain W from PDB  Type:PROTEIN  Length:198
                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeee..eeeeeee..eee..eeee.....eee.....eeeee..hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh.......eeeeeee....eeeeeee..eeeee..eeee..hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.......eeeeeee..eeee............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5a0q W   1 TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPYRCEKG 207
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190 ||     
                                                                                                                                                                                                                         192|     
                                                                                                                                                                                                                          202     

Chain X from PDB  Type:PROTEIN  Length:176
                                                                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee....eeeeeeeeeee..eeee.........eeeee..hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh.......eeeeeeeee...eeeeeee...eeee..................hhhhhhhhhhhhhhhhhh.......eeeeee....... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q X   6 NGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDDFVVSGTCQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITT 196
                                    15        25        35       |49        59        69        79        89        99       109       119    || 138  ||   150       160       170       180       190      
                                                                43|                                                                         124|    141|                                                    
                                                                 48                                                                          134     144                                                    

Chain Y from PDB  Type:PROTEIN  Length:189
                                                                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee..eeeeeee................eee....eeeeee...hhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.......eeeeeee.....eeeeeee..eeeee..eeee..hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.......eeeeee........ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q Y   3 YLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDL 191
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182         

Chain Z from PDB  Type:PROTEIN  Length:192
                                                                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeee..eeeeee...eee..eeee....................hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh.........eeeee..eeeeeee..eeee..........hhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.........eeeee..eeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5a0q Z   1 TTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVAD 194
                                    10        20        30        40        50        60        70        80        90       100    || 112       122       132       142       152       162       172       182       192  
                                                                                                                                  105|                                                                                      
                                                                                                                                   108                                                                                      

Chain a from PDB  Type:PROTEIN  Length:190
                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeeee..eee..eeee.....eee.....eeeee..hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh........eeeee.......................eeee...hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.......eeeeeee..eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q a   8 NGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIRE 205
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147      |165       175       185       195       205
                                                                                                                                                                            154|                                          
                                                                                                                                                                             163                                          

Chain b from PDB  Type:PROTEIN  Length:184
                                                                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeee..eeeeee.................eeeee..eeeeee..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh......eeeeeeee..eeeeeeee..eeeee..eee.......hhhhhhhhhhh......hhhhhhhhhhhh......eeeee........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5a0q b   4 PMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVSYNRFQIATVTEKGVEIE 200
                                    13        23        33        43        53        63        73   ||   89        99       109       119       129       139       149       159       169     ||186       196    
                                                                                                    77|                                                                                        175|                 
                                                                                                     84                                                                                         183                 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5A0Q)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5A0Q)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5A0Q)

(-) Gene Ontology  (60, 489)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    KNM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5a0q)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5a0q
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PSA1_HUMAN | P25786
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA2_HUMAN | P25787
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA3_HUMAN | P25788
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA4_HUMAN | P25789
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA5_HUMAN | P28066
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA6_HUMAN | P60900
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA7_HUMAN | O14818
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB1_HUMAN | P20618
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB2_HUMAN | P49721
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB3_HUMAN | P49720
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB4_HUMAN | P28070
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB5_HUMAN | P28074
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB6_HUMAN | P28072
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB7_HUMAN | Q99436
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.25.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PSA1_HUMAN | P25786
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA2_HUMAN | P25787
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA3_HUMAN | P25788
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA4_HUMAN | P25789
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA5_HUMAN | P28066
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA6_HUMAN | P60900
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA7_HUMAN | O14818
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB1_HUMAN | P20618
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB2_HUMAN | P49721
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB3_HUMAN | P49720
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB4_HUMAN | P28070
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB5_HUMAN | P28074
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB6_HUMAN | P28072
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB7_HUMAN | Q99436
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PSA1_HUMAN | P257864r3o 4r67 5gjq 5gjr 5l4g 5le5 5lex 5ley 5lez 5lf0 5lf1 5lf3 5lf4 5lf6 5lf7 5ln3 5m32 5t0c 5t0g 5t0h 5t0i 5t0j
        PSA2_HUMAN | P257874r3o 4r67 5gjq 5gjr 5l4g 5le5 5lex 5ley 5lez 5lf0 5lf1 5lf3 5lf4 5lf6 5lf7 5ln3 5m32 5t0c 5t0g 5t0h 5t0i 5t0j
        PSA3_HUMAN | P257884r3o 4r67 5dsv 5gjq 5gjr 5l4g 5le5 5lex 5ley 5lez 5lf0 5lf1 5lf3 5lf4 5lf6 5lf7 5ln3 5m32 5t0c 5t0g 5t0h 5t0i 5t0j
        PSA4_HUMAN | P257894r3o 4r67 5gjq 5gjr 5l4g 5le5 5lex 5ley 5lez 5lf0 5lf1 5lf3 5lf4 5lf6 5lf7 5ln3 5m32 5t0c 5t0g 5t0h 5t0i 5t0j
        PSA5_HUMAN | P280664r3o 4r67 5gjq 5gjr 5l4g 5le5 5lex 5ley 5lez 5lf0 5lf1 5lf3 5lf4 5lf6 5lf7 5ln3 5m32 5t0c 5t0g 5t0h 5t0i 5t0j
        PSA6_HUMAN | P609004r3o 4r67 5gjq 5gjr 5l4g 5le5 5lex 5ley 5lez 5lf0 5lf1 5lf3 5lf4 5lf6 5lf7 5ln3 5m32 5t0c 5t0g 5t0h 5t0i 5t0j
        PSA7_HUMAN | O148184r3o 4r67 5gjq 5gjr 5l4g 5le5 5lex 5ley 5lez 5lf0 5lf1 5lf3 5lf4 5lf6 5lf7 5ln3 5m32 5t0c 5t0g 5t0h 5t0i 5t0j
        PSB1_HUMAN | P206184r3o 4r67 5gjq 5gjr 5l4g 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5le5 5lex 5ley 5lez 5lf0 5lf1 5lf3 5lf4 5lf6 5lf7 5ln3 5m2b 5m32 5t0c 5t0g 5t0h 5t0i 5t0j
        PSB2_HUMAN | P497214r3o 4r67 5gjq 5gjr 5l4g 5le5 5lex 5ley 5lez 5lf0 5lf1 5lf3 5lf4 5lf6 5lf7 5ln3 5m32 5t0c 5t0g 5t0h 5t0i 5t0j
        PSB3_HUMAN | P497204r3o 4r67 5gjq 5gjr 5l4g 5le5 5lex 5ley 5lez 5lf0 5lf1 5lf3 5lf4 5lf6 5lf7 5ln3 5m32 5t0c 5t0g 5t0h 5t0i 5t0j
        PSB4_HUMAN | P280704r3o 4r67 5gjq 5gjr 5l4g 5le5 5lex 5ley 5lez 5lf0 5lf1 5lf3 5lf4 5lf6 5lf7 5ln3 5m32 5t0c 5t0g 5t0h 5t0i 5t0j
        PSB5_HUMAN | P280744r3o 4r67 5gjq 5gjr 5l4g 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5le5 5lex 5ley 5lez 5lf0 5lf1 5lf3 5lf4 5lf6 5lf7 5ln3 5m32 5t0c 5t0g 5t0h 5t0i 5t0j
        PSB6_HUMAN | P280724r3o 4r67 5gjq 5gjr 5l4g 5le5 5lex 5ley 5lez 5lf0 5lf1 5lf3 5lf4 5lf6 5lf7 5ln3 5m32 5t0c 5t0g 5t0h 5t0i 5t0j
        PSB7_HUMAN | Q994364r3o 4r67 5gjq 5gjr 5l4g 5le5 5lex 5ley 5lez 5lf0 5lf1 5lf3 5lf4 5lf6 5lf7 5ln3 5m32 5t0c 5t0g 5t0h 5t0i 5t0j

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5A0Q)