Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  THE PLANT PEPTIDE HORMONE RECEPTOR
 
Authors :  J. Chai, J. Wang, Z. Han
Date :  03 Apr 15  (Deposition) - 02 Mar 16  (Release) - 02 Mar 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A,B,P,Q
Biol. Unit 1:  A,Q  (1x)
Biol. Unit 2:  B,P  (1x)
Keywords :  Receptor, Hormone (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Wang, H. Li, Z. Han, H. Zhang, T. Wang, G. Lin, J. Chang, W. Yang, J. Cha
Allosteric Receptor Activation By The Plant Peptide Hormone Phytosulfokine
Nature V. 525 265 2015
PubMed-ID: 26308901  |  Reference-DOI: 10.1038/NATURE14858

(-) Compounds

Molecule 1 - PHYTOSULFOKINE RECEPTOR 1
    Chains: A, B
    EC Number: 2.7.11.1
    Engineered: YES
    Expression System: INSECT CELL EXPRESSION VECTOR PTIE1
    Expression System Taxid: 266783
    Fragment: UNP RESIDUES 24-659
    Gene: PSKR
    Organism Common: WILD CARROT
    Organism Scientific: DAUCUS CAROTA
    Organism Taxid: 4039
    Synonym: DCPSKR1,PHYTOSULFOKINE LRR RECEPTOR KINASE 1
 
Molecule 2 - PHYTOSULFOKINE
    Chains: P, Q
    Engineered: YES
    Organism Scientific: DAUCUS CAROTA
    Organism Taxid: 3701
    Synthetic: YES

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABPQ
Biological Unit 1 (1x): A  Q
Biological Unit 2 (1x):  BP 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 17)

Asymmetric Unit (2, 17)
No.NameCountTypeFull Name
1NAG13Ligand/IonN-ACETYL-D-GLUCOSAMINE
2TYS4Mod. Amino AcidO-SULFO-L-TYROSINE
Biological Unit 1 (2, 7)
No.NameCountTypeFull Name
1NAG5Ligand/IonN-ACETYL-D-GLUCOSAMINE
2TYS2Mod. Amino AcidO-SULFO-L-TYROSINE
Biological Unit 2 (2, 10)
No.NameCountTypeFull Name
1NAG8Ligand/IonN-ACETYL-D-GLUCOSAMINE
2TYS2Mod. Amino AcidO-SULFO-L-TYROSINE

(-) Sites  (18, 18)

Asymmetric Unit (18, 18)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREARG A:302 , TYR A:319 , ASN A:321binding site for residue NAG A 705
02AC2SOFTWAREASN A:116 , VAL A:138 , ASP A:140 , HOH A:822 , HOH A:858 , HOH A:903 , VAL B:75 , SER B:76binding site for Mono-Saccharide NAG A 701 bound to ASN A 116
03AC3SOFTWARESER A:287 , ASN A:288 , ARG A:310 , ASN A:311 , HOH A:817 , HOH A:833 , GLN Q:32binding site for Mono-Saccharide NAG A 703 bound to ASN A 311
04AC4SOFTWARELYS A:359 , LYS A:361 , ASN A:383 , LEU A:409 , HOH A:855binding site for Mono-Saccharide NAG A 702 bound to ASN A 383
05AC5SOFTWAREGLN A:436 , TRP A:458 , ASN A:482 , TYR A:542 , HOH A:866binding site for Mono-Saccharide NAG A 704 bound to ASN A 482
06AC6SOFTWAREVAL A:75 , SER A:76 , ASN B:116 , VAL B:138 , ASP B:140 , HOH B:858 , HOH B:974binding site for Mono-Saccharide NAG B 705 bound to ASN B 116
07AC7SOFTWARESER B:287 , ARG B:310 , ASN B:311 , HOH B:821 , HOH B:996 , GLN P:32binding site for Mono-Saccharide NAG B 703 bound to ASN B 311
08AC8SOFTWAREASN B:300 , ARG B:302 , TYR B:319 , ASN B:321 , ALA B:324 , HOH B:876binding site for Mono-Saccharide NAG B 706 bound to ASN B 321
09AC9SOFTWARESER B:303 , SER B:305 , ASN B:327 , HOH B:830binding site for Mono-Saccharide NAG B 707 bound to ASN B 327
10AD1SOFTWARELYS B:359 , ASN B:383 , LEU B:409 , HOH B:884 , TYS P:30binding site for Mono-Saccharide NAG B 704 bound to ASN B 383
11AD2SOFTWAREGLN B:365 , ASN B:388 , SER B:391 , HOH B:802 , HOH B:807binding site for Mono-Saccharide NAG B 708 bound to ASN B 388
12AD3SOFTWAREGLN B:436 , TRP B:458 , ASN B:482 , TYR B:542 , HOH B:801 , HOH B:872 , HOH B:909 , HOH B:960binding site for Poly-Saccharide residues NAG B 701 through NAG B 702 bound to ASN B 482
13AD4SOFTWARETHR B:408 , LEU B:409 , ILE B:431 , ALA B:433 , SER B:434 , LEU B:453 , ASP B:455 , SER B:457 , TRP B:458 , PHE B:516 , LYS B:517 , LYS B:518 , HOH B:884 , TYS P:30binding site for Di-peptide TYS P 28 and ILE P 29
14AD5SOFTWARESER B:382 , THR B:408 , ILE B:431 , LEU B:453 , ASP B:455 , PHE B:516 , LYS B:518 , NAG B:704 , TYS P:28 , THR P:31binding site for Di-peptide ILE P 29 and TYS P 30
15AD6SOFTWAREASN B:356 , ALA B:358 , SER B:380 , SER B:382 , PRO B:514 , PHE B:516 , LYS B:518 , NAG B:704 , ILE P:29 , GLN P:32binding site for Di-peptide TYS P 30 and THR P 31
16AD7SOFTWARETHR A:408 , ILE A:431 , ALA A:433 , SER A:434 , ASP A:455 , SER A:457 , TRP A:458 , PHE A:516 , LYS A:517 , LYS A:518 , PHE A:534 , HOH A:854 , TYS Q:30binding site for Di-peptide TYS Q 28 and ILE Q 29
17AD8SOFTWARESER A:382 , THR A:408 , ILE A:431 , ASP A:455 , PHE A:516 , LYS A:518 , GLY A:525 , PHE A:534 , TYS Q:28 , THR Q:31 , GLN Q:32binding site for Di-peptide ILE Q 29 and TYS Q 30
18AD9SOFTWAREASN A:356 , ALA A:358 , SER A:380 , SER A:382 , PHE A:513 , PHE A:516 , LYS A:518 , GLY A:525 , HOH A:855 , ILE Q:29 , GLN Q:32binding site for Di-peptide TYS Q 30 and THR Q 31

(-) SS Bonds  (9, 9)

Asymmetric Unit
No.Residues
1A:29 -A:63
2A:64 -A:71
3A:178 -A:205
4A:322 -A:349
5B:29 -B:63
6B:64 -B:71
7B:178 -B:205
8B:322 -B:349
9B:642 -B:649

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4Z5W)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4Z5W)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4Z5W)

(-) Exons   (0, 0)

(no "Exon" information available for 4Z5W)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:596
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh.................hhhhh..eeeee............eeeeeee......eee.hhhhhhh....eee....eee.....hhhhh....eee......eee...........eee....eeeee.............eee....eeee..hhhhhhh....eee....eeee..hhhhhhh....eee....eeee..hhhhhhh....eee....eeee...hhhhh.....eee....ee....hhhhhh.....eee......eee............eee....eee.....hhhhh....eee..........hhhhhhh....eee.......hhhhhhhhhh......eee......................eee..........hhhhhhh....eee..........hhhhhhh....eee..........hhhhhhhhhhhh.....eee..eee.hhhhh..eee..........hhhhhhh....eee..........hhhhhhh....eee..........hhhhhhh....eee...............hhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4z5w A  27 LTCNSNDLKALEGFMRGLESSIDGWKWNESSSFSSNCCDWVGISCKSSVSLGLDDVNESGRVVELELGRRKLSGKLSESVAKLDQLKVLNLTHNSLSGSIAASLLNLSNLEVLDLSSNDFSGLFPSLINLPSLRVLNVYENSFHGLIPASLCNNLPRIREIDLAMNYFDGSIPVGIGNCSSVEYLGLASNNLSGSIPQELFQLSNLSVLALQNNRLSGALSSKLGKLSNLGRLDISSNKFSGKIPDVFLELNKLWYFSAQSNLFNGEMPRSLSNSRSISLLSLRNNTLSGQIYLNCSAMTNLTSLDLASNSFSGSIPSNLPNCLRLKTINFAKIKFIAQIPESFKNFQSLTSLSFSNSSIQNISSALEILQHCQNLKTLVLTLNFQKEELPSVPSLQFKNLKVLIIASCQLRGTVPQWLSNSPSLQLLDLSWNQLSGTIPPWLGSLNSLFYLDLSNNTFIGEIPHSLTSLQSLVSKPDFPFFKKGLQYNQPSSFPPMIDLSYNSLNGSIWPEFGDLRQLHVLNLKNNNLSGNIPANLSGMTSLEVLDLSHNNLSGNIPPSLVKLSFLSTFSVAYNKLSGPIPFQTFPNSSFEGNQG 640
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496     ||514   ||  530       540       550       560       570       580       590       600       610       620 ||    634      
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     502|    518|                                                                                              622|             
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      511     525                                                                                               627             


Chain B from PDB  Type:PROTEIN  Length:601
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh.............hhhhh..eeeee..........eeeeeee..........hhhhhhh....eee......ee....hhhhh....eee....eeeee...........eee....eeeee.............eee....eeee..hhhhhhh....eee....eeee..hhhhhhh....eee....eeee..hhhhhhh....eee....eeee.............eee....ee....hhhhhh.....eee......eee............eee....eee.....hhhhh....eee..........hhhhhhh....eee.......hhhhhhhhhh......eee......................eee..........hhhhhhh....eee..........hhhhhhh....eee..........hhhhhhhhhhhh....eee..ee.hhhhh..eee..........hhhhhhh....eee......ee..hhhhhhh....eee....eeee..hhhhhhh....eee....eeeee.....hhhhhhhhhh....eee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4z5w B  27 LTCNSNDLKALEGFMRGLESSIDGWKWNFSSNCCDWVGISCKSSVSLGLVNESGRVVELELGRRKLSGKLSESVAKLDQLKVLNLTHNSLSGSIAASLLNLSNLEVLDLSSNDFSGLFPSLINLPSLRVLNVYENSFHGLIPASLCNNLPRIREIDLAMNYFDGSIPVGIGNCSSVEYLGLASNNLSGSIPQELFQLSNLSVLALQNNRLSGALSSKLGKLSNLGRLDISSNKFSGKIPDVFLELNKLWYFSAQSNLFNGEMPRSLSNSRSISLLSLRNNTLSGQIYLNCSAMTNLTSLDLASNSFSGSIPSNLPNCLRLKTINFAKIKFIAQIPESFKNFQSLTSLSFSNSSIQNISSALEILQHCQNLKTLVLTLNFQKEELPSVPSLQFKNLKVLIIASCQLRGTVPQWLSNSPSLQLLDLSWNQLSGTIPPWLGSLNSLFYLDLSNNTFIGEIPHSLTSLQSLVSKDFPFFKKLQYNQPSSFPPMIDLSYNSLNGSIWPEFGDLRQLHVLNLKNNNLSGNIPANLSGMTSLEVLDLSHNNLSGNIPPSLVKLSFLSTFSVAYNKLSGPIPTGVQFQTFPNSSFEGNQGLCGEHASPC 649
                                    36        46       |60        70        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502|     |528       538       548       558       568       578       588       598       608       618       628       638       648 
                                                      54|                  79|                                                                                                                                                                                                                                                                                                                                                                                                                                 502|   518|                                                                                                                           
                                                       59                   82                                                                                                                                                                                                                                                                                                                                                                                                                                  512    526                                                                                                                           


Chain P from PDB  Type:PROTEIN  Length:5
                                     
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author .ee.. Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                 4z5w P  28 yIyTQ  32
                            | |  
                           28-TYS
                             30-TYS


Chain Q from PDB  Type:PROTEIN  Length:5
                                     
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author .ee.. Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                 4z5w Q  28 yIyTQ  32
                            | |  
                            | |  
                           28-TYS
                             30-TYS
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4Z5W)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4Z5W)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4Z5W)

(-) Gene Ontology  (13, 13)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TYS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4z5w)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4z5w
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PSKR1_DAUCA | Q8LPB4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSK_DAUCA | P58261
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PSKR1_DAUCA | Q8LPB4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSK_DAUCA | P58261
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PSKR1_DAUCA | Q8LPB4: 4z61 4z62
        PSK_DAUCA | P58261: 4z61 4z63 4z64

(-) Related Entries Specified in the PDB File

4z61 4z62 4z63 4z64