4YPO - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF MYCOBACTERIUM TUBERCULOSIS KETOL-ACID REDUCTOISOMERASE IN COMPLEX WITH MG2+

Authors :   Y. Lv, L. W. Guddat

Date :   13 Mar 15 (Deposition) - 17 Feb 16 (Release) - 27 Apr 16 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.00

Chains :   Asym./Biol. Unit : A,B

Keywords :   Ilvc, Branch Chain Amino Acids, Knotted Protein, Rossmann Fold, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Lv, A. Kandale, S. J. Wun, R. P. Mcgeary, S. J. Williams, B. Kobe, V. Sieber, M. A. Schembri, G. Schenk, L. W. Guddat
Crystal Structure Of Mycobacterium Tuberculosis Ketol-Acid Reductoisomerase At 1. 0 Angstrom Resolution - A Potential Target For Anti-Tuberculosis Drug Discovery.
Febs J. V. 283 1184 2016
PubMed-ID: 26876563 | Reference-DOI: 10.1111/FEBS.13672

Molecule 1 - KETOL-ACID REDUCTOISOMERASE
	Chains	:	A, B
	EC Number	:	1.1.1.86
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI 'BL21-GOLD(DE3)PLYSS AG'
	Expression System Taxid	:	866768
	Fragment	:	RESIDUES 5-337
	Gene	:	ILVC, IQ45_13380, IU12_14180, IU13_13535, IU21_13700, T209_13330
	Organism Scientific	:	MYCOBACTERIUM TUBERCULOSIS
	Organism Taxid	:	1773
	Synonym	:	ACETOHYDROXY-ACID ISOMEROREDUCTASE,ALPHA-KETO-BETA- HYDROXYLACYL REDUCTOISOMERASE

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (3, 16)

No.	Name	Count	Type	Full Name
1	CL	2	Ligand/Ion	CHLORIDE ION
2	MG	13	Ligand/Ion	MAGNESIUM ION
3	NA	1	Ligand/Ion	SODIUM ION

Asymmetric Unit (16, 16)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ASP A:188 , GLU A:192 , HOH A:572 , HOH A:734 , HOH A:757 , HOH B:715	binding site for residue MG A 401
02	AC2	SOFTWARE	HOH A:576 , HOH A:588 , HOH A:962	binding site for residue MG A 402
03	AC3	SOFTWARE	HOH A:559 , HOH A:642 , HOH A:699 , HOH A:872 , HOH A:888 , HOH A:973	binding site for residue MG A 403
04	AC4	SOFTWARE	HOH A:606 , HOH A:611 , HOH A:613 , HOH A:721	binding site for residue MG A 404
05	AC5	SOFTWARE	SER A:24 , GLN A:25 , PRO A:130 , GLY A:131 , HOH A:934	binding site for residue CL A 405
06	AC6	SOFTWARE	GLU A:224 , GLU A:228 , HOH A:539 , HOH A:658 , ASP B:188 , HOH B:609	binding site for residue MG A 406
07	AC7	SOFTWARE	ASP A:250 , HOH A:513 , HOH A:552 , HOH A:592 , HOH A:795 , HOH B:632	binding site for residue MG A 407
08	AC8	SOFTWARE	ASP A:62 , HOH A:511 , HOH A:515 , HOH A:582 , HOH A:737 , HOH B:779	binding site for residue MG A 408
09	AC9	SOFTWARE	SER A:323 , HOH A:612 , GLY B:143	binding site for residue CL A 409
10	AD1	SOFTWARE	ASP A:188 , HOH A:573 , GLU B:224 , GLU B:228 , HOH B:544 , HOH B:687	binding site for residue MG A 410
11	AD2	SOFTWARE	HOH A:517 , HOH A:530 , HOH A:906 , HOH B:678 , HOH B:813 , HOH B:850	binding site for residue MG B 401
12	AD3	SOFTWARE	ASP B:188 , GLU B:192 , HOH B:576 , HOH B:742 , HOH B:747 , HOH B:760	binding site for residue MG B 402
13	AD4	SOFTWARE	ASP B:60 , HOH B:549 , HOH B:554 , HOH B:702 , HOH B:764 , HOH B:811	binding site for residue MG B 403
14	AD5	SOFTWARE	HOH B:708 , HOH B:861 , HOH B:871 , HOH B:880 , HOH B:908 , HOH B:931	binding site for residue MG B 404
15	AD6	SOFTWARE	HOH A:971 , HOH B:537 , HOH B:585 , HOH B:593 , HOH B:712 , HOH B:895	binding site for residue MG B 405
16	AD7	SOFTWARE	ALA B:68 , ALA B:71 , ASN B:94 , LYS B:96 , ASP B:99 , HOH B:583	binding site for residue NA B 406

(no "SS Bond" information available for 4YPO)

(no "Cis Peptide Bond" information available for 4YPO)

(no "SAP(SNP)/Variant" information available for 4YPO)

(no "PROSITE Motif" information available for 4YPO)

(no "Exon" information available for 4YPO)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:325
                                                                                                                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhh.hhhhhh.eeeee..hhhhhhhhhhhhhh..eeeee......hhhhhhhh..eeehhhhhhhhh.eeee..hhhhhhhhhhhhhhhhh....eeee..hhhhhh.........eeeeeee..hhhhhhhhhhh.....eeeeeee....hhhhhhhhhhhhhhhhhhheee.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ypo A   1 MFYDDDADLSIIQGRKVGVIGYGSQGHAHSLSLRDSGVQVRVGLKQGSRSRPKVEEQGLDVDTPAEVAKWADVVMVLAPDTAQAEIFAGDIEPNLKPGDALFFGHGLNVHFGLIKPPADVAVAMVAPKGPGHLVRRQFVDGKGVPCLVAVEQDPRGDGLALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQTVLCGGTEELVKAGFEVMVEAGYPAELAYFEVLHELKLIVDLMYEGGLARMYYSVSDTAEFGGYLSGPRVIDAGTKERMRDILREIQDGSFVHKLVADVEGGNKQLEELRRQNAEHPIEVVGKKLRDLMSWV 325
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320

Chain B from PDB  Type:PROTEIN  Length:325
                                                                                                                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhh.hhhhhh.eeeee.hhhhhhhhhhhhhhh..eeeee......hhhhhhhh..eeehhhhhhhhh.eeee..hhhhhhhhhhhhhhhhh....eeee..hhhhhh.........eeeeeee..hhhhhhhhhhh.....eeeeeee....hhhhhhhhhhhhhhhhhhheee.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ypo B   1 MFYDDDADLSIIQGRKVGVIGYGSQGHAHSLSLRDSGVQVRVGLKQGSRSRPKVEEQGLDVDTPAEVAKWADVVMVLAPDTAQAEIFAGDIEPNLKPGDALFFGHGLNVHFGLIKPPADVAVAMVAPKGPGHLVRRQFVDGKGVPCLVAVEQDPRGDGLALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQTVLCGGTEELVKAGFEVMVEAGYPAELAYFEVLHELKLIVDLMYEGGLARMYYSVSDTAEFGGYLSGPRVIDAGTKERMRDILREIQDGSFVHKLVADVEGGNKQLEELRRQNAEHPIEVVGKKLRDLMSWV 325
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 4YPO)

(no "CATH Domain" information available for 4YPO)

(no "Pfam Domain" information available for 4YPO)

Asymmetric/Biological Unit(hide GO term definitions)

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]
		AD5	[ RasMol ]	+environment [ RasMol ]
		AD6	[ RasMol ]	+environment [ RasMol ]
		AD7	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4ypo)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	4ypo
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ILVC_MYCTU \| P9WKJ7
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.1.1.86
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ILVC_MYCTU \| P9WKJ7
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 4YPO)

(no "Related Entries Specified in the PDB File" available for 4YPO)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 16)

Sites (16, 16)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (10, 10)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File