Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)

(-) Description

Title :  ALPHA-LYTIC PROTEASE COMPLEXED WITH PRO REGION
 
Authors :  N. K. Sauter, T. Mau, S. D. Rader, D. A. Agard
Date :  01 Oct 98  (Deposition) - 18 May 99  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  A,C  (1x)
Biol. Unit 4:  B,D  (1x)
Biol. Unit 5:  A,B,C,D  (1x)
Keywords :  Pro Region, Foldase, Protein Folding, Serine Protease (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  N. K. Sauter, T. Mau, S. D. Rader, D. A. Agard
Structure Of Alpha-Lytic Protease Complexed With Its Pro Region.
Nat. Struct. Biol. V. 5 945 1998
PubMed-ID: 9808037  |  Reference-DOI: 10.1038/2919

(-) Compounds

Molecule 1 - ALPHA-LYTIC PROTEASE
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Cellular LocationINCLUSION BODIES
    Expression System GeneT7
    Expression System PlasmidPT7PRO
    Expression System Taxid562
    Expression System Vector TypeT7 EXPRESSION SYSTEM
    FragmentCHAIN A, B, MATURE PROTEASE. CHAIN C, D, PRO REGION
    Fragment (source)CHAIN C, D
    GeneT7
    MutationYES
    Organism ScientificLYSOBACTER ENZYMOGENES
    Organism Taxid69
 
Molecule 2 - ALPHA-LYTIC PROTEASE
    ChainsC, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Cellular LocationINCLUSION BODIES
    Expression System GeneT7
    Expression System PlasmidPT7PRO
    Expression System Taxid562
    Expression System Vector TypeT7 EXPRESSION SYSTEM
    FragmentCHAIN A, B, MATURE PROTEASE. CHAIN C, D, PRO REGION
    Fragment (source)CHAIN C, D
    GeneT7
    MutationYES
    Organism ScientificLYSOBACTER ENZYMOGENES
    Organism Taxid69

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)AB  
Biological Unit 2 (1x)  CD
Biological Unit 3 (1x)A C 
Biological Unit 4 (1x) B D
Biological Unit 5 (1x)ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4PRO)

(-) Sites  (0, 0)

(no "Site" information available for 4PRO)

(-) SS Bonds  (6, 6)

Asymmetric Unit
No.Residues
1A:17 -A:37
2A:101 -A:111
3A:137 -A:170
4B:17 -B:37
5B:101 -B:111
6B:137 -B:170

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Phe A:59 -Pro A:60
2Phe B:59 -Pro B:60

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4PRO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4PRO)

(-) Exons   (0, 0)

(no "Exon" information available for 4PRO)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:198
                                                                                                                                                                                                                                      
               SCOP domains d4proa_ A: alpha-Lytic protease                                                                                                                                                                        SCOP domains
               CATH domains --4proA01 A:3-76,A:184-196 Trypsin-like serine proteases                    4proA02 A:77-183 Trypsin-like serine proteases                                                             4proA01      -- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeee...eeee..eeeee..eeeeee.hhh.....eeee..eeeeeeeeee.....eeeeee........eeee..eeee...........eeeeee...eeeeee.......eee..eee...eee...........eeee....eeeeeeee............hhh..eeeeehhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4pro A   1 ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG 198
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190        

Chain B from PDB  Type:PROTEIN  Length:198
                                                                                                                                                                                                                                      
               SCOP domains d4prob_ B: alpha-Lytic protease                                                                                                                                                                        SCOP domains
               CATH domains --4proB01 B:3-76,B:184-196 Trypsin-like serine proteases                    4proB02 B:77-183 Trypsin-like serine proteases                                                             4proB01      -- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeee...eeee..eeeee..eeeeee.hhh.....eeee..eeeeeeeeee.....eeeeee........eeee..eeee...........eeeeee...eeeeee.......eee..eee...eee...........eee.....eeeeeeee............hhh..eeeeehhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4pro B   1 ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG 198
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190        

Chain C from PDB  Type:PROTEIN  Length:154
                                                                                                                                                                                          
               SCOP domains d4proc1 C:6-85 Alpha-lytic protease prodomain                                   d4proc2 C:86-166 Alpha-lytic protease prodomain                            SCOP domains
               CATH domains 4proC01 C:6-84  [code=3.30.300.50, no name defined]                            4proC02 C:85-166  [code=3.30.300.50, no name defined]                       CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeee.....eeeeeee............eeee....hhhhhhhhhhhhhhh......eeeeeeehhh.eeeeeee...hhhhhhhhhhh...hhheeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4pro C   6 PQLKFAMQRDLGIFPTQLPQYLQTEKLARTQAAAIEREFGAQFAGSWIERNEDGSFKLVAATSGARKSSTLGGVEVRNVRYSLKQLQSAMEQLDAGANAPLDGVQSWYVDPRSNAVVVKVDDGATDAGVDFVALSGADSAQVRIESSPGKLQTT 166
                                    15        25        35        45        55        65        75        85        95       112       122       132       142       152       162    
                                                                                                                            104|                                                      
                                                                                                                             112                                                      

Chain D from PDB  Type:PROTEIN  Length:155
                                                                                                                                                                                           
               SCOP domains d4prod1 D:5-85 Alpha-lytic protease prodomain                                    d4prod2 D:86-166 Alpha-lytic protease prodomain                            SCOP domains
               CATH domains -4proD01 D:6-84  [code=3.30.300.50, no name defined]                            4proD02 D:85-165  [code=3.30.300.50, no name defined]                     - CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhhhhh...eeeee.....eeeeeee...........eeeee....hhhhhhhhhhhhhhh......eeeeeeehhh.eeeeeee...hhhhhhhhhhh...hhheeeeee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4pro D   5 DPQLKFAMQRDLGIFPTQLPQYLQTEKLARTQAAAIEREFGAQFAGSWIERNEDGSFKLVAATSGARKSSTLGGVEVRNVRYSLKQLQSAMEQLDAGANARLDGVQSWYVDPRSNAVVVKVDDGATDAGVDFVALSGADSAQVRIESSPGKLQTT 166
                                    14        24        34        44        54        64        74        84        94       104||     121       131       141       151       161     
                                                                                                                              105|                                                     
                                                                                                                               113                                                     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 6)

Asymmetric Unit

(-) CATH Domains  (2, 8)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4PRO)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4pro)
 
  Sites
(no "Sites" information available for 4pro)
 
  Cis Peptide Bonds
    Phe A:59 - Pro A:60   [ RasMol ]  
    Phe B:59 - Pro B:60   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4pro
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PRLA_LYSEN | P00778
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PRLA_LYSEN | P00778
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PRLA_LYSEN | P007781boq 1gba 1gbb 1gbc 1gbd 1gbe 1gbf 1gbh 1gbi 1gbj 1gbk 1gbl 1gbm 1p01 1p02 1p03 1p04 1p05 1p06 1p09 1p10 1p11 1p12 1qq4 1qrw 1qrx 1ssx 1tal 2alp 2h5c 2h5d 2lpr 2pro 2ull 3lpr 3m7t 3m7u 3pro 3qgj 3urc 3urd 3ure 5lpr 6lpr 7lpr 8lpr 9lpr

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4PRO)