Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PDE10A WITH IMIDAZO[4,5-B]PYRIDINES AS POTENT AND SELECTIVE INHIBITORS
 
Authors :  S. Chmait
Date :  27 Feb 14  (Deposition) - 23 Jul 14  (Release) - 23 Jul 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.24
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (3x)
Biol. Unit 2:  B  (3x)
Keywords :  Hydrolase-Hydrolase Inhibitor Complex, Hydrolase-Hydrolase Inbhitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. Hu, K. Andrews, S. Chmait, X. Zhao, C. Davis, S. Miller, G. Hill Della Puppa, M. Dovlatyan, H. Chen, D. Lester-Zeiner, J. Able, C. Biorn, J. Ma, J. Shi, J. Treanor, J. R. Allen
Discovery Of Novel Imidazo[4, 5-B]Pyridines As Potent And Selective Inhibitors Of Phosphodiesterase 10A (Pde10A).
Acs Med. Chem. Lett. V. 5 700 2014
PubMed-ID: 24944747  |  Reference-DOI: 10.1021/ML5000993

(-) Compounds

Molecule 1 - CAMP AND CAMP-INHIBITED CGMP 3',5'-CYCLIC PHOSPHODIESTERASE 10A
    ChainsA, B
    EC Number3.1.4.17, 3.1.4.35
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentUNP RESIDUES 442-779
    GenePDE10A
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (3x)A 
Biological Unit 2 (3x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 40)

Asymmetric Unit (4, 40)
No.NameCountTypeFull Name
12KR2Ligand/IonN-[4-(2-METHOXY-3H-IMIDAZO[4,5-B]PYRIDIN-3-YL)PHENYL]-5-METHYLPYRIDIN-2-AMINE
2GOL8Ligand/IonGLYCEROL
3SO426Ligand/IonSULFATE ION
4ZN4Ligand/IonZINC ION
Biological Unit 1 (3, 54)
No.NameCountTypeFull Name
12KR3Ligand/IonN-[4-(2-METHOXY-3H-IMIDAZO[4,5-B]PYRIDIN-3-YL)PHENYL]-5-METHYLPYRIDIN-2-AMINE
2GOL15Ligand/IonGLYCEROL
3SO436Ligand/IonSULFATE ION
4ZN-1Ligand/IonZINC ION
Biological Unit 2 (3, 54)
No.NameCountTypeFull Name
12KR3Ligand/IonN-[4-(2-METHOXY-3H-IMIDAZO[4,5-B]PYRIDIN-3-YL)PHENYL]-5-METHYLPYRIDIN-2-AMINE
2GOL9Ligand/IonGLYCEROL
3SO442Ligand/IonSULFATE ION
4ZN-1Ligand/IonZINC ION

(-) Sites  (40, 40)

Asymmetric Unit (40, 40)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:519 , HIS A:553 , ASP A:554 , ASP A:664 , ZN A:1002 , HOH A:1261 , HOH A:1352binding site for residue ZN A 1001
02AC2SOFTWAREASP A:554 , ZN A:1001 , HOH A:1202 , HOH A:1225 , HOH A:1227 , HOH A:1261 , HOH A:1262binding site for residue ZN A 1002
03AC3SOFTWAREPHE A:472 , GLU A:473 , ASN A:474 , ARG A:510 , ARG A:558 , HOH A:1101 , HOH A:1107 , HOH A:1125binding site for residue SO4 A 1003
04AC4SOFTWARELYS A:497 , GLY A:597 , HIS A:598 , ASN A:599 , HOH A:1215 , HOH A:1254binding site for residue SO4 A 1004
05AC5SOFTWAREVAL A:512 , PRO A:513 , ARG A:558 , GLY A:559 , GLU A:685 , ALA A:688 , HOH A:1144 , HOH A:1380binding site for residue SO4 A 1005
06AC6SOFTWARELEU A:537 , LEU A:646 , ASN A:647 , ARG A:652 , LEU B:537 , LEU B:646 , ASN B:647 , ARG B:652binding site for residue SO4 A 1006
07AC7SOFTWAREARG A:510 , ARG A:511binding site for residue SO4 A 1007
08AC8SOFTWAREPHE A:629 , PHE A:719 , VAL A:723 , GOL A:1018binding site for residue SO4 A 1008
09AC9SOFTWAREGLN A:532 , ASN A:533 , HOH A:1382 , TYR B:639 , SO4 B:814binding site for residue SO4 A 1009
10AD1SOFTWARESER A:577 , THR A:578 , GLN A:583binding site for residue SO4 A 1010
11AD2SOFTWAREASN A:508 , GLN A:588 , SER A:591 , ILE A:592binding site for residue SO4 A 1011
12AD3SOFTWAREASN A:599 , PHE A:601 , SER A:602 , LEU A:604 , TYR A:609binding site for residue SO4 A 1012
13AD4SOFTWARETHR A:539 , ASP A:540 , HOH A:1396 , ASN B:645binding site for residue SO4 A 1013
14AD5SOFTWARESER A:650 , HIS A:651 , ARG A:654binding site for residue GOL A 1014
15AD6SOFTWAREARG A:457 , GLU A:461 , HIS A:466 , PHE A:467 , ASP A:468 , LEU A:671 , HOH A:1111 , HOH A:1121 , HOH A:1146binding site for residue GOL A 1015
16AD7SOFTWAREPRO A:673 , LYS A:676 , LEU A:677binding site for residue GOL A 1016
17AD8SOFTWARELYS A:694 , GLY A:697 , ILE A:698 , GLN A:699 , HOH A:1106 , HOH A:1133 , HOH A:1301binding site for residue GOL A 1017
18AD9SOFTWAREILE A:701 , PRO A:702 , MET A:703 , SO4 A:1008 , 2KR A:1020 , HOH A:1224 , HOH A:1437binding site for residue GOL A 1018
19AE1SOFTWAREARG A:486 , GLN A:532 , HIS A:535 , HOH A:1185 , SO4 B:814binding site for residue SO4 A 1019
20AE2SOFTWAREILE A:682 , TYR A:683 , PRO A:702 , MET A:703 , LYS A:708 , GLU A:711 , GLN A:716 , PHE A:719 , GOL A:1018 , HOH A:1308binding site for residue 2KR A 1020
21AE3SOFTWAREHIS B:519 , HIS B:553 , ASP B:554 , ASP B:664 , HOH B:1033 , HOH B:1091binding site for residue ZN B 801
22AE4SOFTWAREASP B:554 , HOH B:977 , HOH B:982 , HOH B:1033 , HOH B:1058 , HOH B:1090binding site for residue ZN B 802
23AE5SOFTWAREPHE B:472 , GLU B:473 , ASN B:474 , ARG B:510 , ARG B:558 , HIS B:570 , HOH B:902 , HOH B:923binding site for residue SO4 B 803
24AE6SOFTWAREARG B:510 , ARG B:511binding site for residue SO4 B 804
25AE7SOFTWAREPRO B:673 , LYS B:694 , GLY B:697 , ILE B:698 , GLN B:699binding site for residue SO4 B 805
26AE8SOFTWARETHR A:641 , GLY A:642 , SER A:643 , ARG B:486 , SER B:487 , CYS B:488 , GLY B:489 , HIS B:535 , ARG B:543binding site for residue SO4 B 806
27AE9SOFTWARELYS B:497 , GLY B:597 , HIS B:598 , ASN B:599 , HOH B:993 , HOH B:994 , HOH B:1020binding site for residue SO4 B 807
28AF1SOFTWAREASN A:645 , THR B:539 , ASP B:540 , HOH B:1236binding site for residue SO4 B 808
29AF2SOFTWAREASN B:508 , GLN B:588 , ILE B:592 , HOH B:1003binding site for residue SO4 B 809
30AF3SOFTWAREVAL B:512 , PRO B:513 , ARG B:558 , GLY B:559 , GLU B:685 , ALA B:688 , HOH B:925binding site for residue SO4 B 810
31AF4SOFTWAREASN B:680 , TRP B:687 , VAL B:712 , HOH B:1114 , HOH B:1204binding site for residue SO4 B 811
32AF5SOFTWAREASN B:599 , PHE B:601 , SER B:602 , LEU B:604 , TYR B:609binding site for residue SO4 B 812
33AF6SOFTWAREGLU B:739 , LEU B:742 , ARG B:746 , HOH B:1129binding site for residue SO4 B 813
34AF7SOFTWARESO4 A:1009 , SO4 A:1019 , TYR B:639binding site for residue SO4 B 814
35AF8SOFTWARESER B:605 , SER B:606 , HOH B:906binding site for residue SO4 B 815
36AF9SOFTWARELEU B:625 , PHE B:719 , GOL B:819binding site for residue SO4 B 816
37AG1SOFTWAREARG B:457 , GLU B:461 , PHE B:467 , ASP B:468 , HOH B:905 , HOH B:911binding site for residue GOL B 817
38AG2SOFTWAREPRO A:736 , HOH A:1191 , ASN B:533 , PRO B:737 , HOH B:1153 , HOH B:1156binding site for residue GOL B 818
39AG3SOFTWAREPRO B:702 , MET B:703 , SO4 B:816 , 2KR B:820 , HOH B:1008 , HOH B:1155binding site for residue GOL B 819
40AG4SOFTWARESER B:667 , TYR B:683 , PHE B:686 , PRO B:702 , MET B:703 , LYS B:708 , GLU B:711 , GLY B:715 , GLN B:716 , PHE B:719 , GOL B:819 , HOH B:1044binding site for residue 2KR B 820

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4P1R)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4P1R)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4P1R)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4P1R)

(-) Exons   (0, 0)

(no "Exon" information available for 4P1R)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:318
                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhh....hhhhhhhh.........hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4p1r A 442 TSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGE 759
                                   451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751        

Chain B from PDB  Type:PROTEIN  Length:308
                                                                                                                                                                                                                                                                                                                                                    
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh.........hhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4p1r B 452 FTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGE 759
                                   461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4P1R)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4P1R)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4P1R)

(-) Gene Ontology  (24, 24)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2KR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
    AG3  [ RasMol ]  +environment [ RasMol ]
    AG4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4p1r)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4p1r
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PDE10_HUMAN | Q9Y233
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.4.17
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
  3.1.4.35
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PDE10_HUMAN | Q9Y233
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PDE10_HUMAN | Q9Y2331lrb 2oun 2oup 2ouq 2our 2ous 2ouu 2ouv 2ouy 2wey 2y0j 2zmf 3sn7 3sni 3snl 3ui7 3uuo 3wi2 3ws8 3ws9 3wyk 3wyl 3wym 4ael 4ajd 4ajf 4ajg 4ajm 4bbx 4ddl 4dff 4fcb 4fcd 4heu 4hf4 4lkq 4llj 4llk 4llp 4llx 4lm0 4lm1 4lm2 4lm3 4lm4 4mrw 4mrz 4ms0 4msa 4msc 4mse 4msh 4msn 4muw 4mvh 4p0n 4phw 4tpm 4tpp 4wn1 4xy2 4yqh 4ys7 4zo5 5axp 5axq 5b4k 5b4l 5c1w 5c28 5c29 5c2a 5c2e 5c2h 5dh4 5dh5 5ede 5edg 5edh 5edi 5i2r 5k9r 5uwf

(-) Related Entries Specified in the PDB File

4p0n