Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  BETA-ALANYL-COA:AMMONIA LYASE FROM CLOSTRIDIUM PROPIONICUM IN COMPLEX WITH PROPIONYL-COA
 
Authors :  A. Heine, K. Reuter
Date :  30 Sep 13  (Deposition) - 26 Mar 14  (Release) - 03 Sep 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.59
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L
Biol. Unit 1:  A,B,C,D,E,F  (1x)
Biol. Unit 2:  G,H,I,J,K,L  (1x)
Keywords :  Hot Dog Fold, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Heine, G. Herrmann, T. Selmer, F. Terwesten, W. Buckel, K. Reuter
High Resolution Crystal Structure Of Clostridium Propionicu Beta-Alanyl-Coa:Ammonia Lyase, A New Member Of The "Hot Dog Fold" Protein Superfamily.
Proteins V. 82 2041 2014
PubMed-ID: 24623648  |  Reference-DOI: 10.1002/PROT.24557

(-) Compounds

Molecule 1
    Chains: A, B, C, D, E, F, G, H, I, J, K, L
    Organism Scientific: CLOSTRIDIUM PROPIONICUM
    Organism Taxid: 28446

 Structural Features

(-) Chains, Units

  123456789101112
Asymmetric Unit : ABCDEFGHIJKL
Biological Unit 1 (1x): ABCDEF      
Biological Unit 2 (1x):       GHIJKL

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 12)

Asymmetric Unit (1, 12)
No.NameCountTypeFull Name
11VU12Ligand/IonPROPIONYL COENZYME A
Biological Unit 1 (1, 6)
No.NameCountTypeFull Name
11VU6Ligand/IonPROPIONYL COENZYME A
Biological Unit 2 (1, 6)
No.NameCountTypeFull Name
11VU6Ligand/IonPROPIONYL COENZYME A

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREPHE A:51 , LEU A:52 , GLY A:79 , ASN A:80 , GLN A:81 , SER A:82 , SER A:121 , HOH A:351 , HOH A:354 , HOH A:364 , HOH A:366 , HOH A:377 , HOH A:387 , HOH A:394 , HOH A:396 , HOH A:399 , HOH A:408 , HOH A:423 , HOH A:435 , PRO B:143 , HOH B:383 , VAL F:24 , GLY F:26 , GLU F:58 , PHE F:59 , THR F:60 , ALA F:61 , PRO F:62 , HOH F:301 , HOH F:405BINDING SITE FOR RESIDUE 1VU A 201
02AC2SOFTWAREPHE B:51 , LEU B:52 , GLY B:79 , ASN B:80 , GLN B:81 , SER B:82 , SER B:121 , HOH B:332 , HOH B:345 , HOH B:351 , HOH B:363 , HOH B:400 , HOH B:414 , HOH B:416 , HOH B:428 , HOH B:435 , VAL E:24 , GLY E:26 , GLU E:58 , PHE E:59 , THR E:60 , ALA E:61 , PRO E:62 , HOH E:315 , HOH E:318 , HOH E:320 , HOH E:352BINDING SITE FOR RESIDUE 1VU B 201
03AC3SOFTWAREPHE C:51 , LEU C:52 , GLY C:79 , ASN C:80 , GLN C:81 , SER C:82 , SER C:121 , HOH C:336 , HOH C:346 , HOH C:360 , HOH C:361 , HOH C:370 , HOH C:377 , HOH C:392 , HOH C:419 , HOH C:421 , HOH C:430 , HOH C:462 , VAL D:24 , GLY D:26 , GLU D:58 , PHE D:59 , THR D:60 , ALA D:61 , PRO D:62 , HOH D:332BINDING SITE FOR RESIDUE 1VU C 201
04AC4SOFTWAREGLY C:26 , GLU C:58 , PHE C:59 , THR C:60 , ALA C:61 , PRO C:62 , HOH C:329 , PHE D:51 , LEU D:52 , GLY D:79 , ASN D:80 , GLN D:81 , SER D:82 , SER D:121 , HOH D:351 , HOH D:361 , HOH D:368 , HOH D:377 , HOH D:383 , HOH D:390 , HOH D:396 , HOH D:424 , HOH D:431 , HOH D:433 , HOH D:436BINDING SITE FOR RESIDUE 1VU D 201
05AC5SOFTWAREGLY B:26 , GLU B:58 , PHE B:59 , THR B:60 , ALA B:61 , PRO B:62 , HOH B:339 , HOH B:364 , PHE E:51 , LEU E:52 , GLY E:79 , ASN E:80 , GLN E:81 , SER E:82 , SER E:121 , HOH E:336 , HOH E:351 , HOH E:359 , HOH E:371 , HOH E:382 , HOH E:395 , HOH E:417 , HOH E:430BINDING SITE FOR RESIDUE 1VU E 201
06AC6SOFTWAREVAL A:24 , GLY A:26 , GLU A:58 , PHE A:59 , THR A:60 , ALA A:61 , PRO A:62 , HOH A:314 , HOH A:359 , HOH A:365 , PHE F:51 , LEU F:52 , GLY F:79 , ASN F:80 , GLN F:81 , SER F:82 , SER F:121 , HOH F:318 , HOH F:345 , HOH F:375 , HOH F:383 , HOH F:387 , HOH F:409 , HOH F:411 , HOH F:414 , HOH F:421BINDING SITE FOR RESIDUE 1VU F 201
07AC7SOFTWAREPHE G:51 , LEU G:52 , GLY G:79 , ASN G:80 , GLN G:81 , SER G:82 , SER G:121 , HOH G:331 , HOH G:364 , HOH G:365 , HOH G:370 , HOH G:378 , HOH G:382 , HOH G:395 , HOH G:405 , HOH G:427 , PRO H:143 , HOH H:458 , VAL L:24 , GLY L:26 , GLU L:58 , PHE L:59 , THR L:60 , ALA L:61 , PRO L:62 , HOH L:348 , HOH L:355 , HOH L:378 , HOH L:430BINDING SITE FOR RESIDUE 1VU G 201
08AC8SOFTWAREPHE H:51 , LEU H:52 , ASN H:80 , GLN H:81 , SER H:82 , SER H:121 , HOH H:326 , HOH H:350 , HOH H:368 , HOH H:394 , HOH H:402 , HOH H:411 , HOH H:418 , HOH H:422 , HOH H:446 , HOH H:459 , HOH H:461 , VAL K:24 , GLY K:26 , GLU K:58 , PHE K:59 , THR K:60 , ALA K:61 , PRO K:62 , HOH K:370 , HOH K:378 , HOH K:414BINDING SITE FOR RESIDUE 1VU H 201
09AC9SOFTWAREPHE I:51 , LEU I:52 , GLY I:79 , ASN I:80 , GLN I:81 , SER I:82 , SER I:121 , HOH I:317 , HOH I:364 , HOH I:395 , HOH I:397 , HOH I:412 , HOH I:425 , HOH I:445 , HOH I:449 , VAL J:24 , GLY J:26 , GLU J:58 , PHE J:59 , THR J:60 , ALA J:61 , PRO J:62 , HOH J:332 , HOH J:337 , HOH J:342 , HOH J:389BINDING SITE FOR RESIDUE 1VU I 201
10BC1SOFTWAREVAL I:24 , GLY I:26 , GLU I:58 , PHE I:59 , THR I:60 , ALA I:61 , PRO I:62 , HOH I:319 , HOH I:380 , HOH I:413 , PHE J:51 , LEU J:52 , GLY J:79 , ASN J:80 , GLN J:81 , SER J:82 , SER J:121 , HOH J:355 , HOH J:368 , HOH J:411 , HOH J:417 , HOH J:418 , HOH J:419BINDING SITE FOR RESIDUE 1VU J 201
11BC2SOFTWAREGLY H:26 , GLU H:58 , PHE H:59 , THR H:60 , ALA H:61 , PRO H:62 , HOH H:325 , HOH H:339 , PHE K:51 , LEU K:52 , GLY K:79 , ASN K:80 , GLN K:81 , SER K:82 , SER K:121 , HOH K:324 , HOH K:331 , HOH K:346 , HOH K:347 , HOH K:353 , HOH K:354 , HOH K:381 , HOH K:437 , HOH K:444 , HOH K:445BINDING SITE FOR RESIDUE 1VU K 201
12BC3SOFTWAREVAL G:24 , GLY G:26 , GLU G:58 , PHE G:59 , THR G:60 , ALA G:61 , PRO G:62 , HOH G:306 , HOH G:311 , HOH G:334 , HOH G:335 , HOH G:363 , PHE L:51 , LEU L:52 , GLY L:79 , ASN L:80 , GLN L:81 , SER L:82 , SER L:121 , HOH L:366 , HOH L:377 , HOH L:397 , HOH L:422 , HOH L:423 , HOH L:425 , HOH L:438 , HOH L:448BINDING SITE FOR RESIDUE 1VU L 201

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4MZQ)

(-) Cis Peptide Bonds  (12, 12)

Asymmetric Unit
No.Residues
1Glu A:110 -Pro A:111
2Glu B:110 -Pro B:111
3Glu C:110 -Pro C:111
4Glu D:110 -Pro D:111
5Glu E:110 -Pro E:111
6Glu F:110 -Pro F:111
7Glu G:110 -Pro G:111
8Glu H:110 -Pro H:111
9Glu I:110 -Pro I:111
10Glu J:110 -Pro J:111
11Glu K:110 -Pro K:111
12Glu L:110 -Pro L:111

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4MZQ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4MZQ)

(-) Exons   (0, 0)

(no "Exon" information available for 4MZQ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:143
                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeee.hhhhh........hhhhhhhhhhhhhhhhhhhhh...eeeeeeeeee........eeeeeeeeeee...eeeeeeeeeeeeee..........eeeeeeeeeeeeeeeeee.hhhhh....hhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4mzq A   1 MVGKKVVHHLMMSAKDAHYTGNLVNGARIVNQWGDVGTELMVYVDGDISLFLGYKDIEFTAPVYVGDFMEYHGWIEKVGNQSYTCKFEAWKVAKMVDITNPQDTRATACEPPVLCGTATGSLFIAKDNQRGPQESSFKDAKHP 143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   


Chain B from PDB  Type:PROTEIN  Length:143
                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeee.hhhhh.......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeeeee........eeeeeeeeeee...eeeeeeeeeeeeee..........eeeeeeeeeeeeeeeeee.hhhhh....hhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4mzq B   1 MVGKKVVHHLMMSAKDAHYTGNLVNGARIVNQWGDVGTELMVYVDGDISLFLGYKDIEFTAPVYVGDFMEYHGWIEKVGNQSYTCKFEAWKVAKMVDITNPQDTRATACEPPVLCGTATGSLFIAKDNQRGPQESSFKDAKHP 143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   


Chain C from PDB  Type:PROTEIN  Length:143
                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeee.hhhhh.......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeeeee........eeeeeeeeeee...eeeeeeeeeeeeee..........eeeeeeeeeeeeeeeeee.hhhhh....hhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4mzq C   1 MVGKKVVHHLMMSAKDAHYTGNLVNGARIVNQWGDVGTELMVYVDGDISLFLGYKDIEFTAPVYVGDFMEYHGWIEKVGNQSYTCKFEAWKVAKMVDITNPQDTRATACEPPVLCGTATGSLFIAKDNQRGPQESSFKDAKHP 143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   


Chain D from PDB  Type:PROTEIN  Length:143
                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeee.hhhhh........hhhhhhhhhhhhhhhhhhhhh...eeeeeeeeee........eeeeeeeeeee...eeeeeeeeeeeeee..........eeeeeeeeeeeeeeeeee.hhhhh....hhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4mzq D   1 MVGKKVVHHLMMSAKDAHYTGNLVNGARIVNQWGDVGTELMVYVDGDISLFLGYKDIEFTAPVYVGDFMEYHGWIEKVGNQSYTCKFEAWKVAKMVDITNPQDTRATACEPPVLCGTATGSLFIAKDNQRGPQESSFKDAKHP 143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   


Chain E from PDB  Type:PROTEIN  Length:143
                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeee.hhhhh.......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeeeee........eeeeeeeeeee...eeeeeeeeeeeeee..........eeeeeeeeeeeeeeeeee.hhhhh....hhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4mzq E   1 MVGKKVVHHLMMSAKDAHYTGNLVNGARIVNQWGDVGTELMVYVDGDISLFLGYKDIEFTAPVYVGDFMEYHGWIEKVGNQSYTCKFEAWKVAKMVDITNPQDTRATACEPPVLCGTATGSLFIAKDNQRGPQESSFKDAKHP 143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   


Chain F from PDB  Type:PROTEIN  Length:143
                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeee.hhhhh.hhhhh..hhhhhhhhhhhhhhhhhhhhh...eeeeeeeeee........eeeeeeeeeee...eeeeeeeeeeeeee..........eeeeeeeeeeeeeeeeee.hhhhh....hhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4mzq F   1 MVGKKVVHHLMMSAKDAHYTGNLVNGARIVNQWGDVGTELMVYVDGDISLFLGYKDIEFTAPVYVGDFMEYHGWIEKVGNQSYTCKFEAWKVAKMVDITNPQDTRATACEPPVLCGTATGSLFIAKDNQRGPQESSFKDAKHP 143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   


Chain G from PDB  Type:PROTEIN  Length:143
                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeee.hhhhh........hhhhhhhhhhhhhhhhhhhhh...eeeeeeeeee........eeeeeeeeeee...eeeeeeeeeeeeee..........eeeeeeeeeeeeeeeeee.hhhhh....hhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4mzq G   1 MVGKKVVHHLMMSAKDAHYTGNLVNGARIVNQWGDVGTELMVYVDGDISLFLGYKDIEFTAPVYVGDFMEYHGWIEKVGNQSYTCKFEAWKVAKMVDITNPQDTRATACEPPVLCGTATGSLFIAKDNQRGPQESSFKDAKHP 143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   


Chain H from PDB  Type:PROTEIN  Length:143
                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeee.hhhhh.......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeeeee........eeeeeeeeeee...eeeeeeeeeeeeee..........eeeeeeeeeeeeeeeeee.hhhhh....hhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4mzq H   1 MVGKKVVHHLMMSAKDAHYTGNLVNGARIVNQWGDVGTELMVYVDGDISLFLGYKDIEFTAPVYVGDFMEYHGWIEKVGNQSYTCKFEAWKVAKMVDITNPQDTRATACEPPVLCGTATGSLFIAKDNQRGPQESSFKDAKHP 143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   


Chain I from PDB  Type:PROTEIN  Length:143
                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeee.hhhhh.......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeeeee........eeeeeeeeeee...eeeeeeeeeeeeee..........eeeeeeeeeeeeeeeeee.hhhhh....hhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4mzq I   1 MVGKKVVHHLMMSAKDAHYTGNLVNGARIVNQWGDVGTELMVYVDGDISLFLGYKDIEFTAPVYVGDFMEYHGWIEKVGNQSYTCKFEAWKVAKMVDITNPQDTRATACEPPVLCGTATGSLFIAKDNQRGPQESSFKDAKHP 143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   


Chain J from PDB  Type:PROTEIN  Length:143
                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeee.hhhhh.......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeeeee........eeeeeeeeeee...eeeeeeeeeeeeee..........eeeeeeeeeeeeeeeeee.hhhhh....hhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4mzq J   1 MVGKKVVHHLMMSAKDAHYTGNLVNGARIVNQWGDVGTELMVYVDGDISLFLGYKDIEFTAPVYVGDFMEYHGWIEKVGNQSYTCKFEAWKVAKMVDITNPQDTRATACEPPVLCGTATGSLFIAKDNQRGPQESSFKDAKHP 143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   


Chain K from PDB  Type:PROTEIN  Length:143
                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeee.hhhhh.......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeeeee........eeeeeeeeeee...eeeeeeeeeeeeee..........eeeeeeeeeeeeeeeeee.hhhhh....hhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4mzq K   1 MVGKKVVHHLMMSAKDAHYTGNLVNGARIVNQWGDVGTELMVYVDGDISLFLGYKDIEFTAPVYVGDFMEYHGWIEKVGNQSYTCKFEAWKVAKMVDITNPQDTRATACEPPVLCGTATGSLFIAKDNQRGPQESSFKDAKHP 143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   


Chain L from PDB  Type:PROTEIN  Length:143
                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeee.hhhhh........hhhhhhhhhhhhhhhhhhhhh...eeeeeeeeee........eeeeeeeeeee...eeeeeeeeeeeeee..........eeeeeeeeeeeeeeeeee.hhhhh....hhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4mzq L   1 MVGKKVVHHLMMSAKDAHYTGNLVNGARIVNQWGDVGTELMVYVDGDISLFLGYKDIEFTAPVYVGDFMEYHGWIEKVGNQSYTCKFEAWKVAKMVDITNPQDTRATACEPPVLCGTATGSLFIAKDNQRGPQESSFKDAKHP 143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4MZQ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4MZQ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4MZQ)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1VU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:110 - Pro A:111   [ RasMol ]  
    Glu B:110 - Pro B:111   [ RasMol ]  
    Glu C:110 - Pro C:111   [ RasMol ]  
    Glu D:110 - Pro D:111   [ RasMol ]  
    Glu E:110 - Pro E:111   [ RasMol ]  
    Glu F:110 - Pro F:111   [ RasMol ]  
    Glu G:110 - Pro G:111   [ RasMol ]  
    Glu H:110 - Pro H:111   [ RasMol ]  
    Glu I:110 - Pro I:111   [ RasMol ]  
    Glu J:110 - Pro J:111   [ RasMol ]  
    Glu K:110 - Pro K:111   [ RasMol ]  
    Glu L:110 - Pro L:111   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4mzq
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q6KC22_CLOPR | Q6KC22
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q6KC22_CLOPR | Q6KC22
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q6KC22_CLOPR | Q6KC22: 4mtu

(-) Related Entries Specified in the PDB File

4mtu APO STRUCTURE