Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF EBOLA VIRUS VP40 HEXAMER
 
Authors :  Z. A. Bornholdt, D. M. Ableson, E. O. Saphire
Date :  24 Jun 13  (Deposition) - 21 Aug 13  (Release) - 17 Sep 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.50
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A,B,C  (2x)
Keywords :  Ebolavirus Matrix Assembly, Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Z. A. Bornholdt, T. Noda, D. M. Abelson, P. Halfmann, M. R. Wood, Y. Kawaoka, E. O. Saphire
Structural Rearrangement Of Ebola Virus Vp40 Begets Multipl Functions In The Virus Life Cycle.
Cell(Cambridge, Mass. ) V. 154 763 2013
PubMed-ID: 23953110  |  Reference-DOI: 10.1016/J.CELL.2013.07.015

(-) Compounds

Molecule 1 - MATRIX PROTEIN VP40
    ChainsB, C, A
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentUNP RESIDUES 44-326
    GeneVP40
    Organism CommonZEBOV
    Organism ScientificEBOLA VIRUS
    Organism Taxid186538
    SynonymMEMBRANE-ASSOCIATED PROTEIN VP40

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABC
Biological Unit 1 (2x)ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4LDD)

(-) Sites  (0, 0)

(no "Site" information available for 4LDD)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4LDD)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4LDD)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4LDD)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4LDD)

(-) Exons   (0, 0)

(no "Exon" information available for 4LDD)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:137
                                                                                                                                                                         
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........ee....hhhhh.....eeeeeeeeeeeee....eeeeeeeeeeeee.....hhhhhhhhhhh..eeeee....eeeeee.........hhhhhhheeeeehhhhh.......eeeeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ldd A  45 DTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPLPQYFTFDLTALKLITQPLPA 188
                                    54        64        74        84||      96       106       116       126|      139       149       159     ||171       181       
                                                                   85|                                   126|                                165|                    
                                                                    88                                    130                                 168                    

Chain B from PDB  Type:PROTEIN  Length:226
                                                                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........ee....hhhhh.....eeeeeeeeeeeeee..eeeeeeeeeeeeeeee.....hhhhhhhhhhh..eeeee....eeeeee.........hhhhhhheeeeehhhhh.........eeeeeeeeeeeeee.........eee..............hhhhhhhhhhhhhhheeeeee....eeeee.hhhhhhhh..eee.............eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ldd B  45 DTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFTNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDALRPGISFHPKLRPILLPTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLQPIIPVLLPKYIGGDLTMVITQ 309
                                    54        64        74        84        94       104       114       124||     137       147       157       167       177       187     ||205       215   ||  237       247       257       267   ||  287      |303      
                                                                                                          125|                                                             193|              219|                                    271|         294|        
                                                                                                           129                                                              202               232                                     282          301        

Chain C from PDB  Type:PROTEIN  Length:139
                                                                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........ee....hhhhh.....eeeeeeeeeeeeee..eeeeeeeeeeeeeeee.....hhhhhhhhhhh..eeeee.....eeeeee.........hhhhhhheeeeehhhhh.......eeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ldd C  45 DTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVPQYFTFDLTALKLITQPLP 187
                                    54        64        74        84        94       104       114       124||     136       146       156       166|      178         
                                                                                                          125|                                   166|                  
                                                                                                           128                                    169                  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4LDD)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4LDD)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4LDD)

(-) Gene Ontology  (19, 19)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4ldd)
 
  Sites
(no "Sites" information available for 4ldd)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4ldd)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4ldd
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  VP40_EBOZM | Q05128
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  VP40_EBOZM | Q05128
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        VP40_EBOZM | Q051281h2c 1h2d 2kq0 4eje 4ldb 4ldi 4ldm

(-) Related Entries Specified in the PDB File

4ld8 4ldb 4ldi 4ldm