Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF AN LRR PROTEIN WITH TWO SOLENOIDS
 
Authors :  J. Chai, P. Liu, Z. Hu, B. Zhou, S. Liu
Date :  25 Oct 12  (Deposition) - 29 May 13  (Release) - 29 May 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.55
Chains :  Asym./Biol. Unit :  A
Keywords :  Receptor-Like Kinase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  P. Liu, Z. Hu, B. Zhou, S. Liu, J. Chai
Crystal Structure Of An Lrr Protein With Two Solenoids
Cell Res. V. 23 303 2013
PubMed-ID: 23147790  |  Reference-DOI: 10.1038/CR.2012.159

(-) Compounds

Molecule 1 - PROBABLE RECEPTOR PROTEIN KINASE TMK1
    ChainsA
    EC Number2.7.11.1
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Taxid7108
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 1-469
    GeneTMK1, AT1G66150, F15E12.4
    Organism CommonMOUSE-EAR CRESS
    Organism ScientificARABIDOPSIS THALIANA
    Organism Taxid3702

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 7)

Asymmetric/Biological Unit (4, 7)
No.NameCountTypeFull Name
1BMA1Ligand/IonBETA-D-MANNOSE
2FUC1Ligand/IonALPHA-L-FUCOSE
3MAN1Ligand/IonALPHA-D-MANNOSE
4NAG4Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:43 , GLY A:133 , ARG A:157 , ASN A:158 , GLU A:184 , ALA A:273 , PRO A:318 , GLY A:319 , GLU A:320 , ASN A:438 , HOH A:653 , HOH A:697 , HOH A:712 , HOH A:748 , HOH A:999 , HOH A:1029 , HOH A:1109 , HOH A:1112 , HOH A:1146 , HOH A:1147 , HOH A:1150BINDING SITE FOR LINKED RESIDUES A 501 to 505
2AC2SOFTWAREHIS A:240 , ARG A:263 , VAL A:283 , ASN A:285 , ASP A:305 , HOH A:771 , HOH A:821 , HOH A:865 , HOH A:882 , HOH A:896 , HOH A:984 , HOH A:1014 , HOH A:1037BINDING SITE FOR LINKED RESIDUES A 506 to 507

(-) SS Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1A:53 -A:60
2A:314 -A:321
3A:351 -A:359

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4HQ1)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4HQ1)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4HQ1)

(-) Exons   (0, 0)

(no "Exon" information available for 4HQ1)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:424
                                                                                                                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhh..........hhhhh..eee.....eeeee..........hhhhhhh....eee......eee...........eee....eeee.............eee...........hhhhhhh....eee......eee.hhhhh........eee....eeeee.hhhhh.....eee....eeee.hhhhhhh....eee....eeeee...........eee....eeee..hhhhhh.....eee....ee...........eee................hhhhhhhhhhhhhh..hhhhhhhh...........eeee..eeeeee..........hhhhhhh....eee..........hhhhhhh....eee......ee.........eee.....ee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4hq1 A  24 DSDGDLSAMLSLKKSLNPPSSFGWSDPDPCKWTHIVCTGTKRVTRIQIGHSGLQGTLSPDLRNLSELERLELQWNNISGPVPSLSGLASLQVLMLSNNNFDSIPSDVFQGLTSLQSVEIDNNPFKSWEIPESLRNASALQNFSANSANVSGSLPGFLGPDEFPGLSILHLAFNNLEGELPMSLAGSQVQSLWLNGQKLTGDITVLQNMTGLKEVWLHSNKFSGPLPDFSGLKELESLSLRDNSFTGPVPASLLSLESLKVVNLTNNHLQGPVPVFKSSVSVDLDKDSNSFCLSSPGECDPRVKSLLLIASSFDYPPRLAESWKGNDPCTNWIGIACSNGNITVISLEKMELTGTISPEFGAIKSLQRIILGINNLTGMIPQELTTLPNLKTLDVSSNKLFGKVPGFRSNVVVNTNGNPDIGKDK 447
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4HQ1)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4HQ1)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4HQ1)

(-) Gene Ontology  (15, 15)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FUC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4hq1)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4hq1
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TMK1_ARATH | P43298
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TMK1_ARATH | P43298
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4HQ1)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4HQ1)