Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE K184R, L185P MUTANT MANGANESE SUPEROXIDE DISMUTASE FROM CANDIDA ALBICANS CYTOSOL
 
Authors :  Y. Sheng, D. Cascio, J. S. Valentine
Date :  29 Aug 12  (Deposition) - 18 Sep 13  (Release) - 18 Sep 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.94
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P
Biol. Unit 1:  A,B,C,D  (1x)
Biol. Unit 2:  E,F,G,H  (1x)
Biol. Unit 3:  I,J,K,L  (1x)
Biol. Unit 4:  M,N,O,P  (1x)
Keywords :  Mn Superoxide Dismutase, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Sheng, D. Cascio, J. S. Valentine
Crystal Structure Of The K184R, L185P Mutant Manganese Superoxide Dismutase From Candida Albicans Cytosol
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - SUPEROXIDE DISMUTASE
    ChainsA, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
    EC Number1.15.1.1
    EngineeredYES
    Expression SystemSACCHAROMYCES CEREVISIAE
    Expression System PlasmidPVT102U
    Expression System StrainEG110
    Expression System Taxid4932
    Expression System Vector TypePLASMID
    GeneCAJ7.0018, SOD3
    MutationYES
    Organism CommonYEAST
    Organism ScientificCANDIDA ALBICANS
    Organism Taxid5476

 Structural Features

(-) Chains, Units

  12345678910111213141516
Asymmetric Unit ABCDEFGHIJKLMNOP
Biological Unit 1 (1x)ABCD            
Biological Unit 2 (1x)    EFGH        
Biological Unit 3 (1x)        IJKL    
Biological Unit 4 (1x)            MNOP

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 42)

Asymmetric Unit (2, 42)
No.NameCountTypeFull Name
1MN16Ligand/IonMANGANESE (II) ION
2SO426Ligand/IonSULFATE ION
Biological Unit 1 (1, 6)
No.NameCountTypeFull Name
1MN-1Ligand/IonMANGANESE (II) ION
2SO46Ligand/IonSULFATE ION
Biological Unit 2 (1, 8)
No.NameCountTypeFull Name
1MN-1Ligand/IonMANGANESE (II) ION
2SO48Ligand/IonSULFATE ION
Biological Unit 3 (1, 7)
No.NameCountTypeFull Name
1MN-1Ligand/IonMANGANESE (II) ION
2SO47Ligand/IonSULFATE ION
Biological Unit 4 (1, 5)
No.NameCountTypeFull Name
1MN-1Ligand/IonMANGANESE (II) ION
2SO45Ligand/IonSULFATE ION

(-) Sites  (42, 42)

Asymmetric Unit (42, 42)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:32 , HIS A:80 , ASP A:170 , HIS A:174 , HOH A:423BINDING SITE FOR RESIDUE MN A 301
02AC2SOFTWARESER A:102 , ALA A:103 , SER A:205BINDING SITE FOR RESIDUE SO4 A 302
03AC3SOFTWAREHIS B:32 , HIS B:80 , ASP B:170 , HIS B:174 , HOH B:403BINDING SITE FOR RESIDUE MN B 301
04AC4SOFTWAREALA B:103 , SER B:205 , HOH B:406BINDING SITE FOR RESIDUE SO4 B 302
05AC5SOFTWAREHIS C:32 , HIS C:80 , ASP C:170 , HIS C:174 , HOH C:404BINDING SITE FOR RESIDUE MN C 301
06AC6SOFTWARELYS C:125 , VAL C:150 , THR C:151BINDING SITE FOR RESIDUE SO4 C 302
07AC7SOFTWARESER C:102 , ALA C:103 , SER C:205BINDING SITE FOR RESIDUE SO4 C 303
08AC8SOFTWAREHIS D:32 , HIS D:80 , ASP D:170 , HIS D:174 , HOH D:411BINDING SITE FOR RESIDUE MN D 301
09AC9SOFTWARESER D:102 , ALA D:103 , SER D:205 , HOH D:425BINDING SITE FOR RESIDUE SO4 D 302
10BC1SOFTWAREARG B:58 , ILE D:8 , SER D:9 , HIS D:77BINDING SITE FOR RESIDUE SO4 D 303
11BC2SOFTWAREHIS E:32 , HIS E:80 , ASP E:170 , HIS E:174 , HOH E:407BINDING SITE FOR RESIDUE MN E 301
12BC3SOFTWAREALA E:16 , LEU E:17BINDING SITE FOR RESIDUE SO4 E 302
13BC4SOFTWARESER E:102 , ALA E:103 , SER E:205BINDING SITE FOR RESIDUE SO4 E 303
14BC5SOFTWAREHIS F:32 , HIS F:80 , ASP F:170 , HIS F:174 , HOH F:417BINDING SITE FOR RESIDUE MN F 301
15BC6SOFTWARELYS F:125 , VAL F:150 , THR F:151BINDING SITE FOR RESIDUE SO4 F 302
16BC7SOFTWARESER F:102 , ALA F:103 , SER F:205 , HOH F:413BINDING SITE FOR RESIDUE SO4 F 303
17BC8SOFTWAREHIS G:32 , HIS G:80 , ASP G:170 , HIS G:174 , HOH G:426BINDING SITE FOR RESIDUE MN G 301
18BC9SOFTWAREALA G:16 , LEU G:17BINDING SITE FOR RESIDUE SO4 G 302
19CC1SOFTWARESER G:102 , ALA G:103 , SER G:205BINDING SITE FOR RESIDUE SO4 G 303
20CC2SOFTWAREHIS H:32 , HIS H:80 , ASP H:170 , HIS H:174 , HOH H:405BINDING SITE FOR RESIDUE MN H 301
21CC3SOFTWARELYS H:125 , VAL H:150 , THR H:151BINDING SITE FOR RESIDUE SO4 H 302
22CC4SOFTWARESER H:102 , ALA H:103 , SER H:205BINDING SITE FOR RESIDUE SO4 H 303
23CC5SOFTWAREHIS I:32 , HIS I:80 , ASP I:170 , HIS I:174 , HOH I:419BINDING SITE FOR RESIDUE MN I 301
24CC6SOFTWARELYS I:125 , VAL I:150 , THR I:151BINDING SITE FOR RESIDUE SO4 I 302
25CC7SOFTWARESER I:102 , ALA I:103 , SER I:205 , HOH I:408BINDING SITE FOR RESIDUE SO4 I 303
26CC8SOFTWAREHIS J:32 , HIS J:80 , ASP J:170 , HIS J:174 , HOH J:407BINDING SITE FOR RESIDUE MN J 301
27CC9SOFTWAREARG I:58 , ILE J:8 , SER J:9 , HIS J:77 , HOH J:408BINDING SITE FOR RESIDUE SO4 J 302
28DC1SOFTWARESER J:102 , ALA J:103 , SER J:205 , HOH J:475BINDING SITE FOR RESIDUE SO4 J 303
29DC2SOFTWAREHIS K:32 , HIS K:80 , ASP K:170 , HIS K:174 , HOH K:406BINDING SITE FOR RESIDUE MN K 301
30DC3SOFTWARESER K:102 , ALA K:103 , SER K:205 , HOH K:402 , HOH K:464BINDING SITE FOR RESIDUE SO4 K 302
31DC4SOFTWAREHIS L:32 , HIS L:80 , ASP L:170 , HIS L:174 , HOH L:435BINDING SITE FOR RESIDUE MN L 301
32DC5SOFTWARELYS L:125 , VAL L:150 , THR L:151BINDING SITE FOR RESIDUE SO4 L 302
33DC6SOFTWAREASN J:182 , VAL J:183 , LYS L:35BINDING SITE FOR RESIDUE SO4 L 303
34DC7SOFTWAREHIS M:32 , HIS M:80 , ASP M:170 , HIS M:174 , HOH M:411BINDING SITE FOR RESIDUE MN M 301
35DC8SOFTWAREALA M:16 , LEU M:17 , HOH M:448BINDING SITE FOR RESIDUE SO4 M 302
36DC9SOFTWARESER M:102 , ALA M:103 , SER M:205 , HOH M:423BINDING SITE FOR RESIDUE SO4 M 303
37EC1SOFTWAREHIS N:32 , HIS N:80 , ASP N:170 , HIS N:174 , HOH N:402BINDING SITE FOR RESIDUE MN N 301
38EC2SOFTWARELYS N:125 , VAL N:150 , THR N:151BINDING SITE FOR RESIDUE SO4 N 302
39EC3SOFTWAREHIS O:32 , HIS O:80 , ASP O:170 , HIS O:174 , HOH O:410BINDING SITE FOR RESIDUE MN O 301
40EC4SOFTWAREALA O:16 , LEU O:17BINDING SITE FOR RESIDUE SO4 O 302
41EC5SOFTWARESER O:102 , ALA O:103 , SER O:205BINDING SITE FOR RESIDUE SO4 O 303
42EC6SOFTWAREHIS P:32 , HIS P:80 , ASP P:170 , HIS P:174 , HOH P:402BINDING SITE FOR RESIDUE MN P 301

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4GUN)

(-) Cis Peptide Bonds  (16, 16)

Asymmetric Unit
No.Residues
1Glu A:21 -Pro A:22
2Glu B:21 -Pro B:22
3Glu C:21 -Pro C:22
4Glu D:21 -Pro D:22
5Glu E:21 -Pro E:22
6Glu F:21 -Pro F:22
7Glu G:21 -Pro G:22
8Glu H:21 -Pro H:22
9Glu I:21 -Pro I:22
10Glu J:21 -Pro J:22
11Glu K:21 -Pro K:22
12Glu L:21 -Pro L:22
13Glu M:21 -Pro M:22
14Glu N:21 -Pro N:22
15Glu O:21 -Pro O:22
16Glu P:21 -Pro P:22

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4GUN)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4GUN)

(-) Exons   (0, 0)

(no "Exon" information available for 4GUN)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:205
                                                                                                                                                                                                                                             
               SCOP domains d4guna1 A:2-89 automated matches                                                        d4guna2 A:90-206 automated matches                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee.....eeeeeeee.........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gun A   2 ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA 206
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201     

Chain B from PDB  Type:PROTEIN  Length:205
                                                                                                                                                                                                                                             
               SCOP domains d4gunb1 B:2-89 automated matches                                                        d4gunb2 B:90-206 automated matches                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee.....eeeeeeee.........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gun B   2 ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA 206
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201     

Chain C from PDB  Type:PROTEIN  Length:205
                                                                                                                                                                                                                                             
               SCOP domains d4gunc1 C:2-89 automated matches                                                        d4gunc2 C:90-206 automated matches                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeee.........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gun C   2 ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA 206
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201     

Chain D from PDB  Type:PROTEIN  Length:205
                                                                                                                                                                                                                                             
               SCOP domains d4gund1 D:2-89 automated matches                                                        d4gund2 D:90-206 automated matches                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee.....eeeeeeee.........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gun D   2 ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA 206
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201     

Chain E from PDB  Type:PROTEIN  Length:205
                                                                                                                                                                                                                                             
               SCOP domains d4gune1 E:2-89 automated matches                                                        d4gune2 E:90-206 automated matches                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee.....eeeeeeee.........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gun E   2 ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA 206
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201     

Chain F from PDB  Type:PROTEIN  Length:205
                                                                                                                                                                                                                                             
               SCOP domains d4gunf1 F:2-89 automated matches                                                        d4gunf2 F:90-206 automated matches                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeee.........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gun F   2 ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA 206
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201     

Chain G from PDB  Type:PROTEIN  Length:205
                                                                                                                                                                                                                                             
               SCOP domains d4gung1 G:2-89 automated matches                                                        d4gung2 G:90-206 automated matches                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee.....eeeeeeee.........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gun G   2 ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA 206
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201     

Chain H from PDB  Type:PROTEIN  Length:205
                                                                                                                                                                                                                                             
               SCOP domains d4gunh1 H:2-89 automated matches                                                        d4gunh2 H:90-206 automated matches                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee.....eeeeeeee.........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gun H   2 ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA 206
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201     

Chain I from PDB  Type:PROTEIN  Length:205
                                                                                                                                                                                                                                             
               SCOP domains d4guni1 I:2-89 automated matches                                                        d4guni2 I:90-206 automated matches                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee.....eeeeeeee.........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gun I   2 ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA 206
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201     

Chain J from PDB  Type:PROTEIN  Length:205
                                                                                                                                                                                                                                             
               SCOP domains d4gunj1 J:2-89 automated matches                                                        d4gunj2 J:90-206 automated matches                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee.....eeeeeeee.........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gun J   2 ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA 206
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201     

Chain K from PDB  Type:PROTEIN  Length:205
                                                                                                                                                                                                                                             
               SCOP domains d4gunk1 K:2-89 automated matches                                                        d4gunk2 K:90-206 automated matches                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee.....eeeeeeee.........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gun K   2 ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA 206
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201     

Chain L from PDB  Type:PROTEIN  Length:205
                                                                                                                                                                                                                                             
               SCOP domains d4gunl1 L:2-89 automated matches                                                        d4gunl2 L:90-206 automated matches                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee.....eeeeeeee.........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gun L   2 ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA 206
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201     

Chain M from PDB  Type:PROTEIN  Length:205
                                                                                                                                                                                                                                             
               SCOP domains d4gunm1 M:2-89 automated matches                                                        d4gunm2 M:90-206 automated matches                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee.....eeeeeeee.........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gun M   2 ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA 206
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201     

Chain N from PDB  Type:PROTEIN  Length:205
                                                                                                                                                                                                                                             
               SCOP domains d4gunn1 N:2-89 automated matches                                                        d4gunn2 N:90-206 automated matches                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeee.........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gun N   2 ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA 206
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201     

Chain O from PDB  Type:PROTEIN  Length:205
                                                                                                                                                                                                                                             
               SCOP domains d4guno1 O:2-89 automated matches                                                        d4guno2 O:90-206 automated matches                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee.....eeeeeeee.........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gun O   2 ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA 206
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201     

Chain P from PDB  Type:PROTEIN  Length:204
                                                                                                                                                                                                                                            
               SCOP domains d4gunp1 P:3-89 automated matches                                                       d4gunp2 P:90-206 automated matches                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee.....eeeeeeee.........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4gun P   3 TENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA 206
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 32)

Asymmetric Unit
2ad4guna2A:90-206
2bd4gunb2B:90-206
2cd4gunk2K:90-206
2dd4gunl2L:90-206
2ed4gunm2M:90-206
2fd4gunn2N:90-206
2gd4guno2O:90-206
2hd4gunp2P:90-206
2id4gunc2C:90-206
2jd4gund2D:90-206
2kd4gune2E:90-206
2ld4gunf2F:90-206
2md4gung2G:90-206
2nd4gunh2H:90-206
2od4guni2I:90-206
2pd4gunj2J:90-206

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4GUN)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4GUN)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
    DC2  [ RasMol ]  +environment [ RasMol ]
    DC3  [ RasMol ]  +environment [ RasMol ]
    DC4  [ RasMol ]  +environment [ RasMol ]
    DC5  [ RasMol ]  +environment [ RasMol ]
    DC6  [ RasMol ]  +environment [ RasMol ]
    DC7  [ RasMol ]  +environment [ RasMol ]
    DC8  [ RasMol ]  +environment [ RasMol ]
    DC9  [ RasMol ]  +environment [ RasMol ]
    EC1  [ RasMol ]  +environment [ RasMol ]
    EC2  [ RasMol ]  +environment [ RasMol ]
    EC3  [ RasMol ]  +environment [ RasMol ]
    EC4  [ RasMol ]  +environment [ RasMol ]
    EC5  [ RasMol ]  +environment [ RasMol ]
    EC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:21 - Pro A:22   [ RasMol ]  
    Glu B:21 - Pro B:22   [ RasMol ]  
    Glu C:21 - Pro C:22   [ RasMol ]  
    Glu D:21 - Pro D:22   [ RasMol ]  
    Glu E:21 - Pro E:22   [ RasMol ]  
    Glu F:21 - Pro F:22   [ RasMol ]  
    Glu G:21 - Pro G:22   [ RasMol ]  
    Glu H:21 - Pro H:22   [ RasMol ]  
    Glu I:21 - Pro I:22   [ RasMol ]  
    Glu J:21 - Pro J:22   [ RasMol ]  
    Glu K:21 - Pro K:22   [ RasMol ]  
    Glu L:21 - Pro L:22   [ RasMol ]  
    Glu M:21 - Pro M:22   [ RasMol ]  
    Glu N:21 - Pro N:22   [ RasMol ]  
    Glu O:21 - Pro O:22   [ RasMol ]  
    Glu P:21 - Pro P:22   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4gun
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q96UT6_CANAX | Q96UT6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.15.1.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q96UT6_CANAX | Q96UT6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q96UT6_CANAX | Q96UT63qvn

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4GUN)