Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF IRON SUPEROXIDE DISMUTASE FROM LEISHMANIA MAJOR
 
Authors :  Seattle Structural Genomics Center For Infectious Disease (S
Date :  08 May 12  (Deposition) - 16 May 12  (Release) - 03 Jun 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.85
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  E,F  (1x)
Biol. Unit 4:  G,H  (1x)
Biol. Unit 5:  I,J  (1x)
Biol. Unit 6:  K,L  (1x)
Keywords :  Ssgcid, Nih, Niaid, Sbri, Emerald Biostructures, Structural Genomics, National Institute Of Allergy And Infectious Diseases, Seattle Structural Genomics Center For Infectious Disease, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  I. Q. Phan, D. R. Davies, N. S. Moretti, D. Shanmugam, I. Cestari, A. Anupama, J. W. Fairman, T. E. Edwards, K. Stuart, S. Schenkman, P. J. Myler
Iron Superoxide Dismutases In Eukaryotic Pathogens: New Insights From Apicomplexa And Trypanosoma Structures.
Acta Crystallogr F Struct V. 71 615 2015 Biol Commun
PubMed-ID: 25961325  |  Reference-DOI: 10.1107/S2053230X15004185

(-) Compounds

Molecule 1 - SUPEROXIDE DISMUTASE
    ChainsA, B, C, D, E, F, G, H, I, J, K, L
    EC Number1.15.1.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidAVA0421
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneFESODA, LMJF_08_0290
    Organism ScientificLEISHMANIA MAJOR
    Organism Taxid5664
    StrainFRIEDLIN
    SynonymIRON SUPEROXIDE DISMUTASE

 Structural Features

(-) Chains, Units

  123456789101112
Asymmetric Unit ABCDEFGHIJKL
Biological Unit 1 (1x)AB          
Biological Unit 2 (1x)  CD        
Biological Unit 3 (1x)    EF      
Biological Unit 4 (1x)      GH    
Biological Unit 5 (1x)        IJ  
Biological Unit 6 (1x)          KL

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 12)

Asymmetric Unit (1, 12)
No.NameCountTypeFull Name
1FE212Ligand/IonFE (II) ION
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1FE22Ligand/IonFE (II) ION
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1FE22Ligand/IonFE (II) ION
Biological Unit 3 (1, 2)
No.NameCountTypeFull Name
1FE22Ligand/IonFE (II) ION
Biological Unit 4 (1, 2)
No.NameCountTypeFull Name
1FE22Ligand/IonFE (II) ION
Biological Unit 5 (1, 2)
No.NameCountTypeFull Name
1FE22Ligand/IonFE (II) ION
Biological Unit 6 (1, 2)
No.NameCountTypeFull Name
1FE22Ligand/IonFE (II) ION

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:58 , HIS A:108 , ASP A:191 , HIS A:195 , HOH A:401BINDING SITE FOR RESIDUE FE2 A 300
02AC2SOFTWAREHIS B:58 , HIS B:108 , ASP B:191 , HIS B:195 , HOH B:483BINDING SITE FOR RESIDUE FE2 B 300
03AC3SOFTWAREHIS C:58 , HIS C:108 , ASP C:191 , HIS C:195 , HOH C:402BINDING SITE FOR RESIDUE FE2 C 300
04AC4SOFTWAREHIS D:58 , HIS D:108 , ASP D:191 , HIS D:195 , HOH D:401BINDING SITE FOR RESIDUE FE2 D 300
05AC5SOFTWAREHIS E:58 , HIS E:108 , ASP E:191 , HIS E:195 , HOH E:401BINDING SITE FOR RESIDUE FE2 E 300
06AC6SOFTWAREHIS F:58 , HIS F:108 , ASP F:191 , HIS F:195 , HOH F:435BINDING SITE FOR RESIDUE FE2 F 300
07AC7SOFTWAREHIS G:58 , HIS G:108 , ASP G:191 , HIS G:195 , HOH G:459BINDING SITE FOR RESIDUE FE2 G 300
08AC8SOFTWAREHIS H:58 , HIS H:108 , ASP H:191 , HIS H:195 , HOH H:401BINDING SITE FOR RESIDUE FE2 H 300
09AC9SOFTWAREHIS I:58 , HIS I:108 , ASP I:191 , HIS I:195 , HOH I:401BINDING SITE FOR RESIDUE FE2 I 300
10BC1SOFTWAREHIS J:58 , HIS J:108 , ASP J:191 , HIS J:195 , HOH J:404BINDING SITE FOR RESIDUE FE2 J 300
11BC2SOFTWAREHIS K:58 , HIS K:108 , ASP K:191 , HIS K:195 , HOH K:428BINDING SITE FOR RESIDUE FE2 K 300
12BC3SOFTWAREHIS L:58 , HIS L:108 , ASP L:191 , HIS L:195 , HOH L:432BINDING SITE FOR RESIDUE FE2 L 300

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4F2N)

(-) Cis Peptide Bonds  (24, 24)

Asymmetric Unit
No.Residues
1Tyr A:31 -Pro A:32
2Gln A:47 -Pro A:48
3Tyr B:31 -Pro B:32
4Gln B:47 -Pro B:48
5Tyr C:31 -Pro C:32
6Gln C:47 -Pro C:48
7Tyr D:31 -Pro D:32
8Gln D:47 -Pro D:48
9Tyr E:31 -Pro E:32
10Gln E:47 -Pro E:48
11Tyr F:31 -Pro F:32
12Gln F:47 -Pro F:48
13Tyr G:31 -Pro G:32
14Gln G:47 -Pro G:48
15Tyr H:31 -Pro H:32
16Gln H:47 -Pro H:48
17Tyr I:31 -Pro I:32
18Gln I:47 -Pro I:48
19Tyr J:31 -Pro J:32
20Gln J:47 -Pro J:48
21Tyr K:31 -Pro K:32
22Gln K:47 -Pro K:48
23Tyr L:31 -Pro L:32
24Gln L:47 -Pro L:48

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4F2N)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4F2N)

(-) Exons   (0, 0)

(no "Exon" information available for 4F2N)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains d4f2na1 A:22-117 automated matches                                                              d4f2na2 A:118-230 automated matches                                                                               SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............................hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4f2n A  22 CYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221         

Chain B from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains d4f2nb1 B:21-117 automated matches                                                               d4f2nb2 B:118-230 automated matches                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....................hhhhh.....hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4f2n B  21 LCYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230

Chain C from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains d4f2nc1 C:22-117 automated matches                                                              d4f2nc2 C:118-230 automated matches                                                                               SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...................hhhhh.....hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4f2n C  22 CYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221         

Chain D from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains d4f2nd1 D:21-117 automated matches                                                               d4f2nd2 D:118-230 automated matches                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....................hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4f2n D  21 LCYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230

Chain E from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains d4f2ne1 E:22-117 automated matches                                                              d4f2ne2 E:118-230 automated matches                                                                               SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............................hhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4f2n E  22 CYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221         

Chain F from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains d4f2nf1 F:21-117 automated matches                                                               d4f2nf2 F:118-230 automated matches                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....................hhhhh.....hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4f2n F  21 LCYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230

Chain G from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains d4f2ng1 G:22-117 automated matches                                                              d4f2ng2 G:118-230 automated matches                                                                               SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............................hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4f2n G  22 CYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221         

Chain H from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains d4f2nh1 H:21-117 automated matches                                                               d4f2nh2 H:118-230 automated matches                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....................hhhhh.....hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4f2n H  21 LCYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230

Chain I from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains d4f2ni1 I:22-117 automated matches                                                              d4f2ni2 I:118-230 automated matches                                                                               SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...................hhhhh.....hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4f2n I  22 CYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221         

Chain J from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains d4f2nj1 J:21-117 automated matches                                                               d4f2nj2 J:118-230 automated matches                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....................hhhhh.....hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4f2n J  21 LCYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230

Chain K from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains d4f2nk1 K:22-117 automated matches                                                              d4f2nk2 K:118-230 automated matches                                                                               SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...................hhhhh.....hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee....eeeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4f2n K  22 CYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221         

Chain L from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains d4f2nl1 L:22-117 automated matches                                                              d4f2nl2 L:118-230 automated matches                                                                               SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...................hhhhh.....hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4f2n L  22 CYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 24)

Asymmetric Unit
1ad4f2na1A:22-117
1bd4f2nb1B:21-117
1cd4f2nk1K:22-117
1dd4f2nl1L:22-117
1ed4f2nc1C:22-117
1fd4f2nd1D:21-117
1gd4f2ne1E:22-117
1hd4f2nf1F:21-117
1id4f2ng1G:22-117
1jd4f2nh1H:21-117
1kd4f2ni1I:22-117
1ld4f2nj1J:21-117

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4F2N)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4F2N)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FE2  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gln A:47 - Pro A:48   [ RasMol ]  
    Gln B:47 - Pro B:48   [ RasMol ]  
    Gln C:47 - Pro C:48   [ RasMol ]  
    Gln D:47 - Pro D:48   [ RasMol ]  
    Gln E:47 - Pro E:48   [ RasMol ]  
    Gln F:47 - Pro F:48   [ RasMol ]  
    Gln G:47 - Pro G:48   [ RasMol ]  
    Gln H:47 - Pro H:48   [ RasMol ]  
    Gln I:47 - Pro I:48   [ RasMol ]  
    Gln J:47 - Pro J:48   [ RasMol ]  
    Gln K:47 - Pro K:48   [ RasMol ]  
    Gln L:47 - Pro L:48   [ RasMol ]  
    Tyr A:31 - Pro A:32   [ RasMol ]  
    Tyr B:31 - Pro B:32   [ RasMol ]  
    Tyr C:31 - Pro C:32   [ RasMol ]  
    Tyr D:31 - Pro D:32   [ RasMol ]  
    Tyr E:31 - Pro E:32   [ RasMol ]  
    Tyr F:31 - Pro F:32   [ RasMol ]  
    Tyr G:31 - Pro G:32   [ RasMol ]  
    Tyr H:31 - Pro H:32   [ RasMol ]  
    Tyr I:31 - Pro I:32   [ RasMol ]  
    Tyr J:31 - Pro J:32   [ RasMol ]  
    Tyr K:31 - Pro K:32   [ RasMol ]  
    Tyr L:31 - Pro L:32   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4f2n
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q4QIE0_LEIMA | Q4QIE0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.15.1.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q4QIE0_LEIMA | Q4QIE0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4F2N)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4F2N)