Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  HUMAN STK-10 (LOK) KINASE DOMAIN IN DFG-OUT CONFORMATION WITH INHIBITOR DSA-7
 
Authors :  E. A. Merritt, E. T. Larson
Date :  19 Apr 12  (Deposition) - 07 Nov 12  (Release) - 19 Dec 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Serine/Threonine Kinase, Transferase, Transferase-Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  P. Ranjitkar, B. G. Perera, D. L. Swaney, S. B. Hari, E. T. Larson, R. Krishnamurty, E. A. Merritt, J. Villen, D. J. Maly
Affinity-Based Probes Based On Type Ii Kinase Inhibitors.
J. Am. Chem. Soc. V. 134 19017 2012
PubMed-ID: 23088519  |  Reference-DOI: 10.1021/JA306035V

(-) Compounds

Molecule 1 - SERINE/THREONINE-PROTEIN KINASE 10
    ChainsA, B
    EC Number2.7.11.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentKINASE DOMAIN (UNP RESIDUES 18-317)
    GeneSTK10, LOK
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymLYMPHOCYTE-ORIENTED KINASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 8)

Asymmetric/Biological Unit (3, 8)
No.NameCountTypeFull Name
11PE1Ligand/IonPENTAETHYLENE GLYCOL
2CA5Ligand/IonCALCIUM ION
3G6I2Ligand/IonN-{3-[(3-{4-[(4-METHOXYPHENYL)AMINO]-1,3,5-TRIAZIN-2-YL}PYRIDIN-2-YL)AMINO]-4-METHYLPHENYL}-3-(TRIFLUOROMETHYL)BENZAMIDE

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREALA A:63 , GLU A:81 , LEU A:85 , ILE A:93 , VAL A:94 , ILE A:110 , GLU A:111 , PHE A:112 , CYS A:113 , HIS A:155 , LEU A:164 , LEU A:173 , ALA A:174 , ASP A:175 , PHE A:176 , LYS A:181BINDING SITE FOR RESIDUE G6I A 401
2AC2SOFTWAREGLU A:313 , GLU A:316 , HOH A:509 , HOH A:510BINDING SITE FOR RESIDUE CA A 402
3AC3SOFTWAREGLU A:234 , HOH A:519 , HOH A:520 , HOH A:522 , HOH A:523BINDING SITE FOR RESIDUE CA A 403
4AC4SOFTWAREALA B:63 , LYS B:65 , GLU B:81 , LEU B:85 , ILE B:93 , VAL B:94 , ILE B:110 , GLU B:111 , PHE B:112 , CYS B:113 , GLY B:116 , LEU B:164 , LEU B:173 , ALA B:174 , ASP B:175 , PHE B:176 , LYS B:181BINDING SITE FOR RESIDUE G6I B 401
5AC5SOFTWAREGLU B:313 , GLU B:316 , HOH B:526BINDING SITE FOR RESIDUE CA B 402
6AC6SOFTWAREGLU B:168 , HOH B:527BINDING SITE FOR RESIDUE CA B 403
7AC7SOFTWAREGLU B:234 , HOH B:530 , HOH B:531 , HOH B:533 , HOH B:534BINDING SITE FOR RESIDUE CA B 404
8AC8SOFTWAREMET B:205 , MET B:209 , ALA B:250BINDING SITE FOR RESIDUE 1PE B 405

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:206 -B:206

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Thr A:212 -Pro A:213
2Thr B:212 -Pro B:213

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4EQU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4EQU)

(-) Exons   (0, 0)

(no "Exon" information available for 4EQU)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:274
                                                                                                                                                                                                                                                                                                                  
               SCOP domains d4equa_ A: automated matches                                                                                                                                                                                                                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhh.eeeeee...eeeeee.....eeeeeee..hhhhhhhhhhhhh.......eeeeeee..eeeeeee.....hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee............hhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh......hhhhhhhhhhhhhhhhh........hhhhhh..........hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4equ A  24 EHVRRDLDPNEVWEIVGELGKVYKAKNKETGALAAAKVIELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKALRELVAEAKAEVMEE 317
                                    33        48        58        68|       84        94       104       114       124       134       144       154       164       174       193       203       213       223       233       243       253       263       273       283       293       303       313    
                                             42|                  68|                                                                                                         183|                                                                                                                            
                                              48                   75                                                                                                          193                                                                                                                            

Chain B from PDB  Type:PROTEIN  Length:282
                                                                                                                                                                                                                                                                                                                          
               SCOP domains d4equb_ B: automated matches                                                                                                                                                                                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......hhhh.eeeeeeee.....eeeeeee.....eeeeeee..hhhhhhhhhhhhhhh.......eeeeeee..eeeeeee.....hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee.............hhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh......hhhhhhhhhhhhhhhhh........hhhhhh..........hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4equ B  24 EHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLFIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKALRELVAEAKAEVMEE 317
                                    33        43        53        63    ||  77        87        97       107       117       127       137       147       157       167       177     ||195       205       215       225       235       245       255       265       275       285       295       305       315  
                                                                       68|                                                                                                           183|                                                                                                                             
                                                                        73                                                                                                            192                                                                                                                             

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4EQU)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4EQU)

(-) Gene Ontology  (21, 21)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1PE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    G6I  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Thr A:212 - Pro A:213   [ RasMol ]  
    Thr B:212 - Pro B:213   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4equ
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  STK10_HUMAN | O94804
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  STK10_HUMAN | O94804
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        STK10_HUMAN | O948042j7t 4aot 4bc6 4usd 4use 5ajq

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4EQU)