Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CHAETOMIUM THERMOPHILUM MNSOD
 
Authors :  T. Haikarainen, C. Frioux, L. -Q. Zhnag, D. -C. Li, A. C. Papageorgiou
Date :  04 Jun 13  (Deposition) - 18 Dec 13  (Release) - 29 Jan 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Oxidoreductase, Dismutation, Antioxidants, Thermostability, Metal Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Haikarainen, C. Frioux, L. Zhnag, D. Li, A. C. Papageorgiou
Crystal Structure And Biochemical Characterization Of A Manganese Superoxide Dismutase From Chaetomium Thermophilum.
Biochim. Biophys. Acta V. 1844 422 2014
PubMed-ID: 24316252  |  Reference-DOI: 10.1016/J.BBAPAP.2013.11.014

(-) Compounds

Molecule 1 - SUPEROXIDE DISMUTASE
    ChainsA, B, C, D
    EC Number1.15.1.1
    Organism ScientificCHAETOMIUM THERMOPHILUM
    Organism Taxid209285
    SynonymMANGANESE SUPEROXIDE DISMUTASE

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 11)

Asymmetric/Biological Unit (3, 11)
No.NameCountTypeFull Name
1GOL1Ligand/IonGLYCEROL
2MN34Ligand/IonMANGANESE (III) ION
3NA6Ligand/IonSODIUM ION

(-) Sites  (11, 11)

Asymmetric Unit (11, 11)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:26 , HIS A:74 , ASP A:160 , HIS A:164 , HOH A:2187BINDING SITE FOR RESIDUE MN3 A 301
02AC2SOFTWAREASP A:103 , ASN A:137 , HOH A:2313 , ASP D:103 , ASN D:137BINDING SITE FOR RESIDUE NA A 401
03AC3SOFTWARELEU A:168 , GLN A:169 , GLU A:171 , HOH A:2298BINDING SITE FOR RESIDUE NA A 801
04AC4SOFTWARETHR A:142 , HOH A:2316BINDING SITE FOR RESIDUE NA A 901
05AC5SOFTWAREHIS B:26 , HIS B:74 , ASP B:160 , HIS B:164 , HOH B:2103BINDING SITE FOR RESIDUE MN3 B 301
06AC6SOFTWARELEU B:7 , TYR B:9 , ASP B:10 , TYR B:11 , HIS B:27 , HOH B:2022 , GLU C:24 , SER C:28 , LYS C:29BINDING SITE FOR RESIDUE GOL B 351
07AC7SOFTWAREHIS C:26 , HIS C:74 , ASP C:160 , HIS C:164 , HOH C:2167BINDING SITE FOR RESIDUE MN3 C 301
08AC8SOFTWAREPRO A:62 , ASN C:65 , HOH C:2307 , HOH C:2308BINDING SITE FOR RESIDUE NA C 601
09AC9SOFTWARETYR C:34 , TRP C:162BINDING SITE FOR RESIDUE NA C 701
10BC1SOFTWAREHIS D:26 , HIS D:74 , ASP D:160 , HIS D:164 , HOH D:2164BINDING SITE FOR RESIDUE MN3 D 301
11BC2SOFTWARETYR D:9 , TRP D:78 , LEU D:81 , HOH D:2029BINDING SITE FOR RESIDUE NA D 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4BR6)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Glu A:15 -Pro A:16
2Glu B:15 -Pro B:16
3Glu C:15 -Pro C:16
4Glu D:15 -Pro D:16

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4BR6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4BR6)

(-) Exons   (0, 0)

(no "Exon" information available for 4BR6)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:196
 aligned with A5JTR7_9PEZI | A5JTR7 from UniProtKB/TrEMBL  Length:197

    Alignment length:196
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190      
         A5JTR7_9PEZI     1 KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEK 196
               SCOP domains d4br6a1 A:1-83 automated matches                                                   d4br6a2 A:84-196 automated matches                                                                                SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhh.hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeee........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4br6 A   1 KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEK 196
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190      

Chain A from PDB  Type:PROTEIN  Length:196
 aligned with F8V325_9PEZI | F8V325 from UniProtKB/TrEMBL  Length:227

    Alignment length:196
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220      
         F8V325_9PEZI    31 KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEK 226
               SCOP domains d4br6a1 A:1-83 automated matches                                                   d4br6a2 A:84-196 automated matches                                                                                SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhh.hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeee........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4br6 A   1 KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEK 196
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190      

Chain B from PDB  Type:PROTEIN  Length:197
 aligned with A5JTR7_9PEZI | A5JTR7 from UniProtKB/TrEMBL  Length:197

    Alignment length:197
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       
         A5JTR7_9PEZI     1 KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEKA 197
               SCOP domains d4br6b1 B:1-83 automated matches                                                   d4br6b2 B:84-197 automated matches                                                                                 SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee.....eeeeeee........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4br6 B   1 KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEKA 197
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       

Chain B from PDB  Type:PROTEIN  Length:197
 aligned with F8V325_9PEZI | F8V325 from UniProtKB/TrEMBL  Length:227

    Alignment length:197
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       
         F8V325_9PEZI    31 KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEKA 227
               SCOP domains d4br6b1 B:1-83 automated matches                                                   d4br6b2 B:84-197 automated matches                                                                                 SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee.....eeeeeee........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4br6 B   1 KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEKA 197
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       

Chain C from PDB  Type:PROTEIN  Length:197
 aligned with A5JTR7_9PEZI | A5JTR7 from UniProtKB/TrEMBL  Length:197

    Alignment length:197
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       
         A5JTR7_9PEZI     1 KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEKA 197
               SCOP domains d4br6c1 C:1-83 automated matches                                                   d4br6c2 C:84-197 automated matches                                                                                 SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeee........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4br6 C   1 KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEKA 197
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       

Chain C from PDB  Type:PROTEIN  Length:197
 aligned with F8V325_9PEZI | F8V325 from UniProtKB/TrEMBL  Length:227

    Alignment length:197
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       
         F8V325_9PEZI    31 KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEKA 227
               SCOP domains d4br6c1 C:1-83 automated matches                                                   d4br6c2 C:84-197 automated matches                                                                                 SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeee........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4br6 C   1 KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEKA 197
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       

Chain D from PDB  Type:PROTEIN  Length:197
 aligned with A5JTR7_9PEZI | A5JTR7 from UniProtKB/TrEMBL  Length:197

    Alignment length:197
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       
         A5JTR7_9PEZI     1 KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEKA 197
               SCOP domains d4br6d1 D:1-83 automated matches                                                   d4br6d2 D:84-197 automated matches                                                                                 SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeee........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4br6 D   1 KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEKA 197
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       

Chain D from PDB  Type:PROTEIN  Length:197
 aligned with F8V325_9PEZI | F8V325 from UniProtKB/TrEMBL  Length:227

    Alignment length:197
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       
         F8V325_9PEZI    31 KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEKA 227
               SCOP domains d4br6d1 D:1-83 automated matches                                                   d4br6d2 D:84-197 automated matches                                                                                 SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeee........eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4br6 D   1 KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEKA 197
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 8)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4BR6)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4BR6)

(-) Gene Ontology  (6, 12)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (F8V325_9PEZI | F8V325)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0004784    superoxide dismutase activity    Catalysis of the reaction: 2 superoxide + 2 H+ = O2 + hydrogen peroxide.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0019430    removal of superoxide radicals    Any process, acting at the cellular level, involved in removing superoxide radicals (O2-) from a cell or organism, e.g. by conversion to dioxygen (O2) and hydrogen peroxide (H2O2).
    GO:0006801    superoxide metabolic process    The chemical reactions and pathways involving superoxide, the superoxide anion O2- (superoxide free radical), or any compound containing this species.

Chain A,B,C,D   (A5JTR7_9PEZI | A5JTR7)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0004784    superoxide dismutase activity    Catalysis of the reaction: 2 superoxide + 2 H+ = O2 + hydrogen peroxide.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0019430    removal of superoxide radicals    Any process, acting at the cellular level, involved in removing superoxide radicals (O2-) from a cell or organism, e.g. by conversion to dioxygen (O2) and hydrogen peroxide (H2O2).
    GO:0006801    superoxide metabolic process    The chemical reactions and pathways involving superoxide, the superoxide anion O2- (superoxide free radical), or any compound containing this species.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MN3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:15 - Pro A:16   [ RasMol ]  
    Glu B:15 - Pro B:16   [ RasMol ]  
    Glu C:15 - Pro C:16   [ RasMol ]  
    Glu D:15 - Pro D:16   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4br6
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A5JTR7_9PEZI | A5JTR7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  F8V325_9PEZI | F8V325
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.15.1.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A5JTR7_9PEZI | A5JTR7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  F8V325_9PEZI | F8V325
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4BR6)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4BR6)