|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 4BOU) |
Sites (0, 0)| (no "Site" information available for 4BOU) |
SS Bonds (0, 0)| (no "SS Bond" information available for 4BOU) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 4BOU) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 4BOU) |
PROSITE Motifs (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 4BOU) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:141 aligned with OTUD3_HUMAN | Q5T2D3 from UniProtKB/Swiss-Prot Length:398 Alignment length:143 57 67 77 87 97 107 117 127 137 147 157 167 177 187 OTUD3_HUMAN 48 GCEEEFVSFANQLQALGLKLREVPGDGNCLFRALGDQLEGHSRNHLKHRQETVDYMIKQREDFEPFVEDDIPFEKHVASLAKPGTFAGNDAIVAFARNHQLNVVIHQLNAPLWQIRGTEKSSVRELHIAYRYGEHYDSVRRIN 190 SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 4BOU) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 4BOU) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 4BOU) |
Gene Ontology (8, 8)|
Asymmetric Unit(hide GO term definitions) Chain A (OTUD3_HUMAN | Q5T2D3)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|