Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURAL BASIS FOR PROCESSIVITY AND ANTIVIRAL DRUG TOXICITY IN HUMAN MITOCHONDRIAL DNA REPLICASE
 
Authors :  M. R. Szymanski, Y. W. Yin
Date :  15 May 15  (Deposition) - 23 Sep 15  (Release) - 23 Sep 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.44
Chains :  Asym./Biol. Unit :  A,B,C,P,T
Keywords :  Mitochondria, Dna Polymerase, Processivity, Drug Toxicity, Dna Binding Protein-Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. R. Szymanski, V. B. Kuznestov, C. K. Shumate, Q. Meng, Y. -S. Lee, G. Patel, S. S. Patel, Y. W. Yin
Structural Basis For Processivity And Antiviral Drug Toxicity In Human Mitochondrial Dna Replicase
Embo J. V. 34 1959 2015
PubMed-ID: 26056153  |  Reference-DOI: 10.15252/EMBJ.201591520

(-) Compounds

Molecule 1 - DNA POLYMERASE SUBUNIT GAMMA-1
    ChainsA
    EC Number2.7.7.7
    EngineeredYES
    Expression SystemINSECT CELL EXPRESSION VECTOR PTIE1
    Expression System Taxid266783
    FragmentUNP RESIDUES 30-1239
    GenePOLG, MDP1, POLG1, POLGA
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMITOCHONDRIAL DNA POLYMERASE CATALYTIC SUBUNIT,POLG-ALPHA
 
Molecule 2 - DNA POLYMERASE SUBUNIT GAMMA-2, MITOCHONDRIAL
    ChainsB, C
    EC Number2.7.7.7
    EngineeredYES
    Expression SystemINSECT CELL EXPRESSION VECTOR PTIE1
    Expression System Taxid266783
    GenePOLG2, MTPOLB
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymDNA POLYMERASE GAMMA ACCESSORY 55 KDA SUBUNIT,P55, MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT,MTPOLB,POLG-BETA
 
Molecule 3 - DNA (25-MER)
    ChainsT
    EngineeredYES
    Organism ScientificLOBARIELLA SOREDIANS
    Organism Taxid1283102
    SyntheticYES
 
Molecule 4 - DNA (5'- D(P*AP*AP*GP*AP*CP*GP*AP*GP*GP*GP*CP*CP*AP*GP*TP*GP*CP*CP*GP*TP*AP*C) -3')
    ChainsP
    EngineeredYES
    Organism ScientificLOBARIELLA SOREDIANS
    Organism Taxid1283102
    SyntheticYES

 Structural Features

(-) Chains, Units

  12345
Asymmetric/Biological Unit ABCPT

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 4)

Asymmetric/Biological Unit (3, 4)
No.NameCountTypeFull Name
1DCP1Ligand/Ion2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE
2DOC1Mod. Nucleotide2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE
3MG2Ligand/IonMAGNESIUM ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:1135 , MG A:4002 , DCP A:4003 , DOC P:24binding site for residue MG A 4001
2AC2SOFTWAREASP A:890 , VAL A:891 , ASP A:1135 , MG A:4001 , DCP A:4003binding site for residue MG A 4002
3AC3SOFTWAREARG A:853 , ASP A:890 , VAL A:891 , ASP A:892 , SER A:893 , GLN A:894 , GLU A:895 , HIS A:932 , LYS A:947 , TYR A:951 , ASP A:1135 , MG A:4001 , MG A:4002 , DOC P:24 , DG T:4 , DA T:5binding site for residue DCP A 4003
4AC4SOFTWAREARG A:853 , LEU A:860 , ALA A:862 , ASN A:864 , ARG A:866 , HIS A:1134 , MG A:4001 , DCP A:4003 , DT P:22 , DA T:5 , DT T:6 , DA T:7binding site for Di-nucleotide DA P 23 and DOC P 24

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4ZTZ)

(-) Cis Peptide Bonds  (46, 46)

Asymmetric/Biological Unit
No.Residues
1Met A:78 -Leu A:79
2Gly A:91 -Gly A:92
3Glu A:93 -Met A:94
4His A:110 -Gly A:111
5Gly A:132 -Asp A:133
6Gly A:206 -Thr A:207
7Gln A:262 -Glu A:263
8Gly A:286 -Ser A:287
9Ser A:475 -Gly A:476
10Phe A:495 -Lys A:496
11Lys A:502 -Val A:503
12Ser A:593 -Leu A:594
13Leu A:594 -Gln A:595
14Ser A:642 -Ala A:643
15Tyr A:739 -Asn A:740
16Leu A:752 -Pro A:753
17Pro A:765 -Phe A:766
18Thr A:778 -Leu A:779
19Gly A:782 -Pro A:783
20Pro A:783 -Gly A:784
21Tyr A:831 -Asp A:832
22Thr A:849 -Ile A:850
23Ile A:850 -Thr A:851
24Asp A:892 -Ser A:893
25Thr A:938 -Val A:939
26Val A:939 -Gly A:940
27Ser A:942 -Arg A:943
28Thr A:989 -Lys A:990
29Pro A:1073 -Val A:1074
30Val A:1074 -Leu A:1075
31Leu A:1075 -Gly A:1076
32Gln A:1089 -Glu A:1090
33Gly A:1169 -Leu A:1170
34Gln A:1214 -Gly A:1215
35Leu B:204 -Pro B:205
36Arg B:389 -Gly B:390
37Gly B:390 -Pro B:391
38Leu B:393 -Glu B:394
39Met B:421 -Gln B:422
40His C:96 -Pro C:97
41Arg C:122 -Glu C:123
42Phe C:293 -Pro C:294
43Pro C:316 -Gly C:317
44Gly C:317 -Asn C:318
45Leu C:418 -Glu C:419
46Glu C:419 -Thr C:420

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ZTZ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ZTZ)

(-) Exons   (0, 0)

(no "Exon" information available for 4ZTZ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:983
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................hhhhhhhhhhhhhhhh......................hhhhhhhhhhhhhhhhhhhhhhhhhh..............eeeee.hhh.eeee......eee.eeee.hhhh..eeeeeee....eeeee............................eeee..hhhhhhhhhhhh.......eeeehhhhhhhhhh.hhhhhhhhh........hhhhh....hhhhhhhhhh..........hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh....eeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhh.......................................hhhhhhhhhhhhhhh...............hhhhhhh.....................hhhhhhh.......................................hhhhhhhhhhh..................................................hhhhhhhhhhhhhhhhhhhhhhhhh...ee.hhhhhhhhhhhh........eeee....eeee....eee..hhhhh..........hhhhhh.....eeeeeee...hhhhhhhhhhhhhhh.......hhhhhh........hhhhhhhh.....hhhhhhhhhhhhh..hhhhhhhhhhhhhh.hhhhhhhhhhhhh.......................................hhhhhhhhh..........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeee..eeeeeee..hhhhhhhhhhhhhhhhhhhhhhh...............eeee.......................................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4ztz A   78 MLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQKHGLWGQPAVPLPDVELRLPPLYGDNLDQHFRLLAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGPEGEAVPVAIPEERALVFAVAVCLAEGTCPTLAVAISPSAWYSWCSQRLVEERYSWTSQLSPADLIPLEVQEQLVVGHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQRSLWIAAKAISSWDWLDISSVNSLAEVHRLYVGGPPLEKEPRELFVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLANDACQLLSGERYKEDPWLWDLEWDLQEFKQKKAKKVKKEPATALGPCSEEEEFQQDVMARACLQKLKGTTELLPKRPQHLPGHPGWYRKLCPRLDDPAWTPGPSLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLNLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEPYNDVDIPGCWFFKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRHPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTK 1228
                                    87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247 ||    269       279       289       299       309      |343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503      |532       542       552       562       572       582       592       602       612       622||     638       648       658   ||  743       753       763       773       783       793       803       813       823       833       843       853       863       873       883       893       903       913       923       933       943       953       963       973       983      1025      1035      1045      1055      1065      1075      1085      1095      1105      1115      1125      1135      1145      1155      1165      1175      1185      1195      1205      1215      1225   
                                                                                                                                                                                                     249|                                                   316|                                                                                                                                                                      510|                                                                                          623|                             662|                                                                                                                                                                                                                                                           992|                                                                                                                                                                                                           
                                                                                                                                                                                                      262                                                    341                                                                                                                                                                       530                                                                                           630                              738                                                                                                                                                                                                                                                           1025                                                                                                                                                                                                           

Chain B from PDB  Type:PROTEIN  Length:363
                                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhh.........hhhhhhhh.....hhhhhhhhhhhhhhhhhh.......eee................hhhhhhhhhhhhhh......eeeeeeeeeeeee....eeeeeeeeeeeeeehhhhhhhhhhhhhhhhhhhhhh...hhh.eeeeeee.....eeeeeeeee..eeeeeeeeeee.hhhhhhhh..hhhhh.ee....ee..eeeeeeeehhhhhhhhhhhhh......................eeeeee........hhhhhhhhhhhhh...eee........hhhhhhhhhhh....eeeeeehhhhhh.eeeeee.....eeeeehhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4ztz B   68 ALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV  485
                                    77        87        97       107       117       127       179       189       199       209       219 ||    236       246       256       266       276       286       296       306       316       326       336       346       362       372       382       392       402       412       422       432       442       452       462       472       482   
                                                                                              136|                                       221|                                                                                                                           355|                                                                                                                           
                                                                                               179                                        229                                                                                                                            362                                                                                                                           

Chain C from PDB  Type:PROTEIN  Length:358
                                                                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....................hhhhhhh......hhhhhhhhhhhhhhhhhh.......eee................hhhhhhhhhhhhhhh.....eeeeeeeeeeeee....eeeeeeeeeeeeeehhhhhhhhhhhhhhhhhhhhhhh..hhh.eeeeee.......eeeeee......eeeeeeeee.................ee....ee..eeeeeeeehhhhhhhhhhhhh................eeeee....hhhhhhhhhhhhhhhhhh...eee.........hhhhhhhhhhh...eeeee.hhhhh..eeeeee.....eeeee..hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4ztz C   67 EALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV  485
                                    76        86        96       106       116       126       136||     188       198       208       218||     235       245       255       265       275       285       295       305       315       325       335       345       355|      377       387       397       407       417       427       437       447       457       467       477        
                                                                                                137|                                    219|                                                                                                                             355|                                                                                                                     
                                                                                                 180                                     227                                                                                                                              368                                                                                                                     

Chain P from PDB  Type:DNA  Length:22
                                                       
                4ztz P    3 AAGACGAGGGCCAGTGCCGTAc   24
                                    12        22 |
                                                24-DOC

Chain T from PDB  Type:DNA  Length:25
                                                          
                4ztz T    2 GCGATACGGCACTGGCCCTCGTCTT   26
                                    11        21     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4ZTZ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ZTZ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ZTZ)

(-) Gene Ontology  (38, 49)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    DCP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DOC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg B:389 - Gly B:390   [ RasMol ]  
    Arg C:122 - Glu C:123   [ RasMol ]  
    Asp A:892 - Ser A:893   [ RasMol ]  
    Gln A:1089 - Glu A:1090   [ RasMol ]  
    Gln A:1214 - Gly A:1215   [ RasMol ]  
    Gln A:262 - Glu A:263   [ RasMol ]  
    Glu A:93 - Met A:94   [ RasMol ]  
    Glu C:419 - Thr C:420   [ RasMol ]  
    Gly A:1169 - Leu A:1170   [ RasMol ]  
    Gly A:132 - Asp A:133   [ RasMol ]  
    Gly A:206 - Thr A:207   [ RasMol ]  
    Gly A:286 - Ser A:287   [ RasMol ]  
    Gly A:782 - Pro A:783   [ RasMol ]  
    Gly A:91 - Gly A:92   [ RasMol ]  
    Gly B:390 - Pro B:391   [ RasMol ]  
    Gly C:317 - Asn C:318   [ RasMol ]  
    His A:110 - Gly A:111   [ RasMol ]  
    His C:96 - Pro C:97   [ RasMol ]  
    Ile A:850 - Thr A:851   [ RasMol ]  
    Leu A:1075 - Gly A:1076   [ RasMol ]  
    Leu A:594 - Gln A:595   [ RasMol ]  
    Leu A:752 - Pro A:753   [ RasMol ]  
    Leu B:204 - Pro B:205   [ RasMol ]  
    Leu B:393 - Glu B:394   [ RasMol ]  
    Leu C:418 - Glu C:419   [ RasMol ]  
    Lys A:502 - Val A:503   [ RasMol ]  
    Met A:78 - Leu A:79   [ RasMol ]  
    Met B:421 - Gln B:422   [ RasMol ]  
    Phe A:495 - Lys A:496   [ RasMol ]  
    Phe C:293 - Pro C:294   [ RasMol ]  
    Pro A:1073 - Val A:1074   [ RasMol ]  
    Pro A:765 - Phe A:766   [ RasMol ]  
    Pro A:783 - Gly A:784   [ RasMol ]  
    Pro C:316 - Gly C:317   [ RasMol ]  
    Ser A:475 - Gly A:476   [ RasMol ]  
    Ser A:593 - Leu A:594   [ RasMol ]  
    Ser A:642 - Ala A:643   [ RasMol ]  
    Ser A:942 - Arg A:943   [ RasMol ]  
    Thr A:778 - Leu A:779   [ RasMol ]  
    Thr A:849 - Ile A:850   [ RasMol ]  
    Thr A:938 - Val A:939   [ RasMol ]  
    Thr A:989 - Lys A:990   [ RasMol ]  
    Tyr A:739 - Asn A:740   [ RasMol ]  
    Tyr A:831 - Asp A:832   [ RasMol ]  
    Val A:1074 - Leu A:1075   [ RasMol ]  
    Val A:939 - Gly A:940   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4ztz
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DPOG1_HUMAN | P54098
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  DPOG2_HUMAN | Q9UHN1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.7.7
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  DPOG1_HUMAN | P54098
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  DPOG2_HUMAN | Q9UHN1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DPOG1_HUMAN | P540983ikm 4ztu 5c51 5c52 5c53
        DPOG2_HUMAN | Q9UHN12g4c 3ikl 3ikm 4ztu 5c51 5c52 5c53

(-) Related Entries Specified in the PDB File

4ztu