Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF CALCIUM-BOUND REGULATORY DOMAIN OF THE HUMAN ATP-MG/PI CARRIER IN THE P212121 FORM
 
Authors :  S. P. D. Harborne, J. J. Ruprecht, E. R. S. Kunji
Date :  16 Apr 15  (Deposition) - 22 Jul 15  (Release) - 29 Jul 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Ef-Hand, Atp-Mg/Pi, Carrier, Calcium, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. P. Harborne, J. J. Ruprecht, E. R. Kunji
Calcium-Induced Conformational Changes In The Regulatory Domain Of The Human Mitochondrial Atp-Mg/Pi Carrier.
Biochim. Biophys. Acta V. 1847 1245 2015
PubMed-ID: 26164100  |  Reference-DOI: 10.1016/J.BBABIO.2015.07.002

(-) Compounds

Molecule 1 - CALCIUM-BINDING MITOCHONDRIAL CARRIER PROTEIN SCAMC-1
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemLACTOCOCCUS LACTIS
    Expression System PlasmidPNZ8048
    Expression System StrainNZ9000
    Expression System Taxid1358
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 14-174
    GeneSLC25A24, APC1, MCSC1, SCAMC1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMITOCHONDRIAL ATP-MG/PI CARRIER PROTEIN 1,MITOCHONDRIAL CA(2+)-DEPENDENT SOLUTE CARRIER PROTEIN 1,SMALL CALCIUM-BINDING MITOCHONDRIAL CARRIER PROTEIN 1,SOLUTE CARRIER FAMILY 25 MEMBER 24

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A   
Biological Unit 2 (1x) B  
Biological Unit 3 (1x)  C 
Biological Unit 4 (1x)   D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 22)

Asymmetric Unit (3, 22)
No.NameCountTypeFull Name
1CA13Ligand/IonCALCIUM ION
2GOL3Ligand/IonGLYCEROL
3SO46Ligand/IonSULFATE ION
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2GOL1Ligand/IonGLYCEROL
3SO43Ligand/IonSULFATE ION
Biological Unit 2 (2, 2)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2GOL1Ligand/IonGLYCEROL
3SO41Ligand/IonSULFATE ION
Biological Unit 3 (2, 2)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2GOL1Ligand/IonGLYCEROL
3SO41Ligand/IonSULFATE ION
Biological Unit 4 (1, 1)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2GOL-1Ligand/IonGLYCEROL
3SO41Ligand/IonSULFATE ION

(-) Sites  (22, 22)

Asymmetric Unit (22, 22)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:32 , ASN A:34 , ASP A:36 , VAL A:38 , GLU A:43binding site for residue CA A 1001
02AC2SOFTWAREASP A:68 , ASN A:70 , ASP A:72 , LYS A:74 , GLU A:79binding site for residue CA A 1002
03AC3SOFTWAREASN A:101 , ASP A:103 , LYS A:105 , GLU A:107 , GLU A:110 , HOH A:1112binding site for residue CA A 1003
04AC4SOFTWAREPRO A:54 , TYR A:150 , ASN A:154binding site for residue SO4 A 1004
05AC5SOFTWAREPRO A:21 , THR A:22 , ARG A:23 , TYR A:24 , GLU A:25 , THR A:26 , ASN C:50binding site for residue SO4 A 1005
06AC6SOFTWAREGLY A:56 , GLN A:57 , ASP A:58 , HOH A:1101binding site for residue GOL A 1006
07AC7SOFTWAREVAL A:136 , HOH A:1102 , PRO C:54 , LEU C:55 , TYR C:150 , ASN C:154binding site for residue SO4 A 1007
08AC8SOFTWAREASP B:32 , ASN B:34 , ASP B:36 , VAL B:38 , GLU B:43 , HOH B:1102binding site for residue CA B 1001
09AC9SOFTWAREASP B:68 , ASN B:70 , ASP B:72 , LYS B:74 , GLU B:79 , HOH B:1106binding site for residue CA B 1002
10AD1SOFTWAREASP B:99 , ASN B:101 , ASP B:103 , LYS B:105 , GLU B:110 , HOH B:1104binding site for residue CA B 1003
11AD2SOFTWARETHR B:22 , ARG B:23 , TYR B:24 , GLU B:25 , THR B:26 , ASN D:50binding site for residue SO4 B 1004
12AD3SOFTWAREGLY B:56 , GLN B:57 , ASP B:58 , ALA B:59binding site for residue GOL B 1005
13AD4SOFTWAREASP C:32 , ASN C:34 , ASP C:36 , VAL C:38 , GLU C:43 , HOH C:1101binding site for residue CA C 1001
14AD5SOFTWAREASP C:68 , ASN C:70 , ASP C:72 , LYS C:74 , GLU C:79 , HOH C:1105binding site for residue CA C 1002
15AD6SOFTWAREASP C:99 , ASN C:101 , ASP C:103 , LYS C:105 , GLU C:110binding site for residue CA C 1003
16AD7SOFTWAREASP C:135 , ASP C:137 , THR C:139 , THR C:141 , GLU C:146binding site for residue CA C 1004
17AD8SOFTWAREARG A:33 , ARG C:23 , TYR C:24 , GLU C:25 , THR C:26binding site for residue SO4 C 1005
18AD9SOFTWAREGLY C:56 , GLN C:57 , ASP C:58 , ALA C:59 , HOH C:1102 , HOH C:1103binding site for residue GOL C 1006
19AE1SOFTWAREASP D:32 , ASN D:34 , ASP D:36 , VAL D:38 , ASP D:40 , GLU D:43binding site for residue CA D 1001
20AE2SOFTWAREASP D:68 , ASN D:70 , ASP D:72 , LYS D:74 , GLU D:79binding site for residue CA D 1002
21AE3SOFTWAREASP D:99 , ASN D:101 , ASP D:103 , LYS D:105 , GLU D:110 , HOH D:1102binding site for residue CA D 1003
22AE4SOFTWAREARG D:23 , TYR D:24 , THR D:26binding site for residue SO4 D 1004

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4ZCV)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4ZCV)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ZCV)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ZCV)

(-) Exons   (0, 0)

(no "Exon" information available for 4ZCV)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:154
                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhh.....eehhhhhhhhhhhh....hhhhhhhhhhhhh......eehhhhhhhhhhhhhhhhhhhhhhh.....eehhhhhhhhhhhh....hhhhhhhhhhhhh......eehhhhhhhh......hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zcv A  21 PTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDI 174
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170    

Chain B from PDB  Type:PROTEIN  Length:152
                                                                                                                                                                                        
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhh.....eehhhhhhhhhhhh....hhhhhhhhhhhhh......eehhhhhhhhhhhhhhhhhhhhhhh.....eehhhhhhhhhhhh....hhhhhhhhhhhhh......eehhhhhhhhh.....hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zcv B  22 TRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGID 173
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171  

Chain C from PDB  Type:PROTEIN  Length:151
                                                                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhh.......hhhhhhhhhhhh....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh.....eehhhhhhhhhhh.....hhhhhhhhhhhhh......eehhhhhhhhh.....hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zcv C  23 RYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGID 173
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172 

Chain D from PDB  Type:PROTEIN  Length:146
                                                                                                                                                                                  
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhh.....eehhhhhhhhhhhh....hhhhhhhhhhhhh......eehhhhhhhhhhhhhhhhhhhhhhh.....eehhhhhhhhhhhh....hhhhhhhhhhhhh....eehhhhhhhhh.....hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zcv D  23 RYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHST 170
                                    32        42        52        62        72        82        92       102       112       122       132   ||  144       154       164      
                                                                                                                                           136|                               
                                                                                                                                            139                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4ZCV)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ZCV)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ZCV)

(-) Gene Ontology  (16, 16)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4zcv)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4zcv
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SCMC1_HUMAN | Q6NUK1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SCMC1_HUMAN | Q6NUK1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SCMC1_HUMAN | Q6NUK14n5x 4zcu

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4ZCV)