Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN GGT1
 
Authors :  S. S. Terzyan, M. H. Hanigan
Date :  10 Apr 15  (Deposition) - 03 Jun 15  (Release) - 22 Jul 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Ntn-Hydrolase Family, Glycoprotein, N- Glycosylation, Cell Surface, Hydrolase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. S. Terzyan, A. W. Burgett, A. Heroux, C. A. Smith, B. H. Mooers, M. H. Hanigan
Human Gamma-Glutamyl Transpeptidase 1: Structures Of The Free Enzyme, Inhibitor-Bound Tetrahedral Transition States, And Glutamate-Bound Enzyme Reveal Novel Movement Within The Active Site During Catalysis.
J. Biol. Chem. V. 290 17576 2015
PubMed-ID: 26013825  |  Reference-DOI: 10.1074/JBC.M115.659680
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - GAMMA-GLUTAMYLTRANSPEPTIDASE 1
    Chains: A
    EC Number: 2.3.2.2, 3.4.19.13, 3.4.19.14
    Engineered: YES
    Expression System: PICHIA
    Expression System Plasmid: PPICZAA
    Expression System Strain: X-33
    Expression System Taxid: 4919
    Expression System Vector Type: PLASMID
    Fragment: LARGE SUBUNIT (UNP RESIDUES 28-380)
    Gene: GGT1, GGT
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: GGT 1,GAMMA-GLUTAMYLTRANSFERASE 1,GLUTATHIONE HYDROLASE 1, LEUKOTRIENE-C4 HYDROLASE
 
Molecule 2 - GAMMA-GLUTAMYLTRANSPEPTIDASE 1
    Chains: B
    EC Number: 2.3.2.2, 3.4.19.13, 3.4.19.14
    Engineered: YES
    Expression System: PICHIA
    Expression System Plasmid: PPICZAA
    Expression System Strain: X-33
    Expression System Taxid: 4919
    Expression System Vector Type: PLAZMID
    Fragment: SMALL SUBUNIT (UNP RESIDUES 381-569)
    Gene: GGT1, GGT
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: GGT 1,GAMMA-GLUTAMYLTRANSFERASE 1,GLUTATHIONE HYDROLASE 1, LEUKOTRIENE-C4 HYDROLASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 11)

Asymmetric/Biological Unit (4, 11)
No.NameCountTypeFull Name
1CL2Ligand/IonCHLORIDE ION
2MES2Ligand/Ion2-(N-MORPHOLINO)-ETHANESULFONIC ACID
3NA1Ligand/IonSODIUM ION
4NAG6Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (11, 11)

Asymmetric Unit (11, 11)
No.NameEvidenceResiduesDescription
01AC1SOFTWARECYS A:192 , GLU A:193 , CYS A:196 , ARG A:197 , ASP A:198 , ARG A:199 , HOH A:791 , HOH A:800binding site for residue MES A 606
02AC2SOFTWARELEU A:210 , PRO A:211 , GLN A:212 , LEU A:213 , ARG B:409binding site for residue CL A 607
03AC3SOFTWAREASN A:180 , LYS A:181 , LEU B:402 , TYR B:403 , THR B:539 , HOH B:1240 , HOH B:1283binding site for residue MES B 1102
04AC4SOFTWAREASP A:46 , ALA B:382 , HIS B:383 , ALA B:472 , VAL B:543 , GLN B:545binding site for residue CL B 1103
05AC5SOFTWAREHIS A:36 , HOH A:882 , LYS B:496 , ALA B:556 , ALA B:557 , HOH B:1251binding site for residue NA B 1104
06AC6SOFTWAREASN A:95 , ARG A:147 , HIS A:148 , ARG A:150 , HOH A:799 , HOH A:823 , HOH A:827 , HOH A:871 , ASP B:390 , SER B:392binding site for Mono-Saccharide NAG A 601 bound to ASN A 95
07AC7SOFTWARETHR A:117 , MET A:118 , ASN A:120 , GLN A:124 , PRO A:306 , HOH A:721 , HOH A:724 , HOH A:758 , ASP B:520 , ALA B:522 , HOH B:1233binding site for Mono-Saccharide NAG A 602 bound to ASN A 120
08AC8SOFTWAREASN A:230 , ASN A:254binding site for Mono-Saccharide NAG A 605 bound to ASN A 230
09AC9SOFTWAREASN A:266 , TYR A:275 , ARG A:343 , PHE A:349binding site for Mono-Saccharide NAG A 604 bound to ASN A 266
10AD1SOFTWAREGLU A:340 , ASN A:344 , PHE A:350 , GLN A:353 , HOH A:787binding site for Mono-Saccharide NAG A 603 bound to ASN A 344
11AD2SOFTWAREGLU A:218 , PRO A:365 , ILE A:366 , HOH A:786 , ASN B:511 , HIS B:531 , HIS B:533 , HOH B:1276binding site for Mono-Saccharide NAG B 1101 bound to ASN B 511

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:50 -A:74
2A:192 -A:196

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Ala A:279 -Pro A:280
2Leu B:509 -Pro B:510

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4Z9O)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4Z9O)

(-) Exons   (0, 0)

(no "Exon" information available for 4Z9O)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:342
                                                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...ee...eee..hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh........eeeeeeee....eeeeeee..............hhhhhhhhhhhh...hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhee.hhhhhhhhhhhhhhhhhhhhhhhhhee..ee.....ee.hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh....hhhhhhhh..eee...eeeee..eeeee.....hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhh........hhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4z9o A  34 DNHVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDAVLYMPSAPLSGPVLALILNILKGYNFSRESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFFAAQLRAQISDDTTHPISYYKPEFYT 375
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373  


Chain B from PDB  Type:PROTEIN  Length:189
                                                                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.....eeeeeee........ee......ee.hhhhhh.............hhhhh.............eeeee....eeeeeeeehhhhhhhhhhhhhhhhhh...hhhhhhhh..ee.......eee....hhhhhhhhhhh...eee......eeeeeeee..eeeee.........ee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4z9o B 381 TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY 569
                                   390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4Z9O)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4Z9O)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4Z9O)

(-) Gene Ontology  (27, 27)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MES  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:279 - Pro A:280   [ RasMol ]  
    Leu B:509 - Pro B:510   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4z9o
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GGT1_HUMAN | P19440
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.3.2.2
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
  3.4.19.13
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
  3.4.19.14
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GGT1_HUMAN | P19440
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GGT1_HUMAN | P19440: 4gdx 4gg2 4zbk 4zc6 4zcg 5v4q

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4Z9O)