Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THE KINASE DOMAIN OF HUMAN SPLEEN TYROSINE (SYK) IN COMPLEX WITH GTC000226
 
Authors :  D. O. Somers
Date :  03 Mar 15  (Deposition) - 30 Sep 15  (Release) - 30 Sep 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.22
Chains :  Asym./Biol. Unit :  A
Keywords :  Syk, Non-Receptor Tyrosine Kinase, Spleen Tyrosine Kinase, Transferase, Phosphorylation, Transferase-Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Liddle, F. L. Atkinson, M. D. Barker, P. S. Carter, N. R. Curtis, R. P. Davis, C. Douault, M. C. Dickson, D. Elwes, N. S. Garton, M. Gray, T. G. Hayhow, C. I. Hobbs, E. Jones, S. Leach, K. Leavens, H. D. Lewis, S. Mccleary, M. Neu, V. K. Patel, A. G. Preston, C. Ramirez-Molina, T. J. Shipley, P. A. Skone, N. Smithers, D. O. Somers, A. L. Walker, R. J. Watson, G. G. Weingarten
Discovery Of Gsk143, A Highly Potent, Selective And Orally Efficacious Spleen Tyrosine Kinase Inhibitor.
Bioorg. Med. Chem. Lett. V. 21 6188 2011
PubMed-ID: 21903390  |  Reference-DOI: 10.1016/J.BMCL.2011.07.082

(-) Compounds

Molecule 1 - TYROSINE-PROTEIN KINASE SYK
    ChainsA
    EC Number2.7.10.2
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Cell LineSF9
    Expression System CommonFALL ARMYWORM
    Expression System Taxid7108
    FragmentUNP RESIDUES 355-635
    GeneSYK
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymSPLEEN TYROSINE KINASE,P72-SYK

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
14DN1Ligand/Ion3-[{2-[(1,1-DIOXIDO-2,3-DIHYDRO-1,2-BENZOTHIAZOL-6-YL)AMINO]PYRIMIDIN-4-YL}(1H-INDAZOL-4-YL)AMINO]PROPAN-1-OL

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:377 , ALA A:400 , LYS A:402 , GLU A:420 , LEU A:446 , MET A:448 , GLU A:449 , MET A:450 , ALA A:451 , GLY A:454 , PRO A:455 , LEU A:501 , SER A:511 , ASP A:512binding site for residue 4DN A 701

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4YJS)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4YJS)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4YJS)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4YJS)

(-) Exons   (0, 0)

(no "Exon" information available for 4YJS)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:257
                                                                                                                                                                                                                                                                                                 
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhh.eeeeeee..eeeeeeee....eeeeeeeee.hhhhhhhhhhhhh.........eeeeee...eeeeee....eehhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eeeee..eeee......ee.......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yjs A 364 YLDRKLLTLEDKELGTVKKGYYQMKKVVKTVAVKILALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYD 632
                                   373   ||  388       398     ||415       425       435       445       455       465       475       485       495       505       515       525       535       545       555       565       575       585       595       605       615       625       
                                       377|                  404|                                                                                                                                                                                                                            
                                        383                   412                                                                                                                                                                                                                            

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4YJS)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4YJS)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4YJS)

(-) Gene Ontology  (87, 87)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    4DN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4yjs)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4yjs
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KSYK_HUMAN | P43405
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.10.2
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  KSYK_HUMAN | P43405
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KSYK_HUMAN | P434051a81 1csy 1csz 1xba 1xbb 1xbc 3buw 3emg 3fqe 3fqh 3fqs 3srv 3tub 3tuc 3tud 3vf8 3vf9 4dfl 4dfn 4f4p 4fl1 4fl2 4fl3 4fyn 4fyo 4fz6 4fz7 4gfg 4i0r 4i0s 4i0t 4puz 4pv0 4px6 4rss 4rx7 4rx8 4rx9 4wnm 4xg2 4xg3 4xg4 4xg6 4xg7 4xg8 4xg9 4yjo 4yjp 4yjq 4yjr 4yjt 4yju 4yjv 5c26 5c27 5cxh 5cxz 5cy3 5ghv 5lma 5lmb 5t68 5tiu 5tr6 5tt7

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4YJS)