Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  LOW RESOLUTION STRUCTURE OF LCAT IN COMPLEX WITH FAB1
 
Authors :  D. E. Piper, N. P. C. Walker, W. G. Romanow, S. T. Thibault
Date :  29 Jan 15  (Deposition) - 29 Jul 15  (Release) - 09 Sep 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.60
Chains :  Asym. Unit :  A,B,E,G,H,J,L,M,O
Biol. Unit 1:  A,H,L  (1x)
Biol. Unit 2:  B,E,G  (1x)
Biol. Unit 3:  J,M,O  (1x)
Keywords :  A/B Hydrolase, Complex, Hydrolase-Immune System Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. E. Piper, W. G. Romanow, R. N. Gunawardane, P. Fordstrom, S. Masterman, O. Pan, S. T. Thibault, R. Zhang, D. Meininger, M. Schwarz, Z. Wang, C. King, M. Zhou, N. P. Walker
The High-Resolution Crystal Structure Of Human Lcat.
J. Lipid Res. V. 56 1711 2015
PubMed-ID: 26195816  |  Reference-DOI: 10.1194/JLR.M059873

(-) Compounds

Molecule 1 - FAB1 LIGHT CHAIN
    ChainsL, G, O
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
 
Molecule 2 - FAB1 HEAVY CHAIN
    ChainsH, E, M
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
 
Molecule 3 - PHOSPHATIDYLCHOLINE-STEROL ACYLTRANSFERASE
    ChainsA, B, J
    EC Number2.3.1.43
    EngineeredYES
    Expression SystemHOMO SAPIENS
    Expression System Taxid9606
    GeneLCAT
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymLECITHIN-CHOLESTEROL ACYLTRANSFERASE,PHOSPHOLIPID- CHOLESTEROL ACYLTRANSFERASE

 Structural Features

(-) Chains, Units

  123456789
Asymmetric Unit ABEGHJLMO
Biological Unit 1 (1x)A   H L  
Biological Unit 2 (1x) BEG     
Biological Unit 3 (1x)     J MO

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 9)

Asymmetric Unit (1, 9)
No.NameCountTypeFull Name
1NAG9Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 1 (1, 3)
No.NameCountTypeFull Name
1NAG3Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 2 (1, 3)
No.NameCountTypeFull Name
1NAG3Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 3 (1, 3)
No.NameCountTypeFull Name
1NAG3Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:84 , SER A:87 , LEU A:89 , ASP H:84binding site for Mono-Saccharide NAG A 501 bound to ASN A 84
2AC2SOFTWARESER A:267 , PRO A:269 , ASN A:272binding site for Mono-Saccharide NAG A 502 bound to ASN A 272
3AC3SOFTWAREASN A:384 , GLU A:388binding site for Mono-Saccharide NAG A 503 bound to ASN A 384
4AC4SOFTWAREASN B:84 , SER B:87binding site for Mono-Saccharide NAG B 501 bound to ASN B 84
5AC5SOFTWAREASN B:272binding site for Mono-Saccharide NAG B 502 bound to ASN B 272
6AC6SOFTWAREASN B:384binding site for Mono-Saccharide NAG B 503 bound to ASN B 384
7AC7SOFTWAREASN J:84 , SER J:86 , SER J:87binding site for Mono-Saccharide NAG J 501 bound to ASN J 84
8AC8SOFTWARESER J:267 , PRO J:269 , ASN J:272binding site for Mono-Saccharide NAG J 502 bound to ASN J 272
9AC9SOFTWAREASN J:384 , GLU J:388binding site for Mono-Saccharide NAG J 503 bound to ASN J 384

(-) SS Bonds  (16, 16)

Asymmetric Unit
No.Residues
1A:50 -A:74
2A:313 -A:356
3B:50 -B:74
4B:313 -B:356
5E:22 -E:96
6E:153 -E:209
7G:22 -G:87
8G:135 -G:194
9H:22 -H:96
10H:153 -H:209
11J:50 -J:74
12J:313 -J:356
13L:22 -L:87
14L:135 -L:194
15M:22 -M:96
16O:22 -O:87

(-) Cis Peptide Bonds  (12, 12)

Asymmetric Unit
No.Residues
1Tyr L:141 -Pro L:142
2Phe H:159 -Pro H:160
3Glu H:161 -Pro H:162
4Trp A:61 -Leu A:62
5Phe A:331 -Pro A:332
6Tyr G:141 -Pro G:142
7Phe E:159 -Pro E:160
8Glu E:161 -Pro E:162
9Trp B:61 -Leu B:62
10Phe B:331 -Pro B:332
11Trp J:61 -Leu J:62
12Phe J:331 -Pro J:332

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4XX1)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4XX1)

(-) Exons   (0, 0)

(no "Exon" information available for 4XX1)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:369
                                                                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee.......eeeee.................eeee........hhhhhhhhhhheeee....eeee...eeee......hhhhhh.........hhhhhhhhhhh.......eee.......hhhhhhhhhhhhhhhhhhhhhhhh..eeeeeehhhhhhhhhhhhh.hhhhhhhheeeeeee.......hhhhhhhhh.................................ee....ee...hhhhhhhhh.hhhhhhhhhhhhh..........eeeeeeee.eeeeeeee...........eeeeeee....hhhhhhhhhh........eeeeeee..hhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xx1 A  21 HTRPVILVPGCLGNQLEAKLDKPDVVNWMCYRKTEDFFTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSSKLAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYFLLRQPQAWKDRFIDGFISLGAPWGGSIKPMLVLASGDNQGKLKEEQRITTTSPWMFPSRMAWPEDHVFISTPSFNYTGRDFQRFFADLHFEEGWYMWLQSRDLLAGLPAPGVEVYCLYGVGLPTPRTYIYDHGFPYTDPVGVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTLEHINAILLG 396
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230|      247       257       267       277       287       297       307       317       327       337       347       357       367       377       387         
                                                                                                                                                                                                                                           230|                                                                                                                                                              
                                                                                                                                                                                                                                            238                                                                                                                                                              

Chain B from PDB  Type:PROTEIN  Length:369
                                                                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee.......eeee..................eeee.hhhhh..hhhhhhhhhhheee......eee....eee......hhhhhh.........hhhhhhhhhh........eee.......hhhhhhhhhhhhhhhhhhhhhhhh..eeeeeehhhhhhhhhhhhhhhhhhhhhheeeeeee.......hhhhhhhhh.................................ee....ee...hhhhhhhhh..hhhhhhhhhhh............eeeeeee.eeeeeeeee........eeeeeeeee....hhhhhhhhhhhhhhh...eeeeeee....hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xx1 B  21 HTRPVILVPGCLGNQLEAKLDKPDVVNWMCYRKTEDFFTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSSKLAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYFLLRQPQAWKDRFIDGFISLGAPWGGSIKPMLVLASGDNQGKLKEEQRITTTSPWMFPSRMAWPEDHVFISTPSFNYTGRDFQRFFADLHFEEGWYMWLQSRDLLAGLPAPGVEVYCLYGVGLPTPRTYIYDHGFPYTDPVGVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTLEHINAILLG 396
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230|      247       257       267       277       287       297       307       317       327       337       347       357       367       377       387         
                                                                                                                                                                                                                                           230|                                                                                                                                                              
                                                                                                                                                                                                                                            238                                                                                                                                                              

Chain E from PDB  Type:PROTEIN  Length:219
                                                                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee..eee.....eeeeeeee..hhhhh.eeeeee.....eeeeeee......eee.hhhh..eeeeee....eeeeee...hhhhheeeeeeee.............eeee...eeeee........eeeee...eeeeeeeeee.....eeee.hhh....eee...eee...eeeeeeeeeehhhhh.....eeeee.hhhh.eeeee..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xx1 E   2 VQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKFYEDSVKGRFTISRDNSKNTLYLQMDSLRAEDTAVYYCAREGAAVRSFYYSYYGMDVWGQGTTVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSHSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS 228
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       149       159       169       179       189       199       209       219         
                                                                                                                                                                   139|                                                                                
                                                                                                                                                                    148                                                                                

Chain G from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ........eeee.....eeeeee.......eeeeeee......eeee.............eeeeee..eeeeee.........eeeeeee............eeee........eeeee..hhhhhh...eeeeeeeeee.....eeeeee..ee....eee...ee.....eee.eeeeehhhhhhhh..eeeeeee..eeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4xx1 G   1 SYELTQPPSVSVSPGQTASITCSGDKLGNKFTSWYQRKPGQSPVLVIYQDTKRPSGIPERFSGSTSGNTATLTISGTQAMDEADYYCQAWDSSTAWVFGGGTKLEVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT 210
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Chain H from PDB  Type:PROTEIN  Length:219
                                                                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee...eee.....eeeeeeee........eeeeee......eeeeee......eee.hhhh..eeeeeehhh.eeeeee........eeeeeeee.............eeee...eeeee.........eeee...eeeeeeee........eeee........eee.............eeeeeee.........eeeeeehhhheeeeee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xx1 H   2 VQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKFYEDSVKGRFTISRDNSKNTLYLQMDSLRAEDTAVYYCAREGAAVRSFYYSYYGMDVWGQGTTVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSHSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK 227
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       148       158       168       178       188       198       208       218         
                                                                                                                                                                   139|                                                                                
                                                                                                                                                                    147                                                                                

Chain J from PDB  Type:PROTEIN  Length:361
                                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee.......eee...................eeee.hhhhh..hhhhhhhhhh.eee......eee.............hhhhhh.........hhhhhhhhhh........eee.......hhhhh....hhhhhhhhhhhhhhh..eeeeeehhhhhhhhhhhhhh.hhhhhh.eeeeeee.......hhhhhhhhhh........hhhhh............ee....eehhhhhhhhhhh.....hhhhhhhhh...........eeeeeeee.eeeeeeee...........eeeeeee....hhhhhhhhhh........eeeeeee...hhhhh.hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xx1 J  21 HTRPVILVPGCLGNQLEAKLDKPDVVNWMCYRKTEDFFTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSSKLAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYFLLRQPQAWKDRFIDGFISLGAPWGGSIKPMLVLASGDNQRITTTSPWMFPSRMAWPEDHVFISTPSFNYTGRDFQRFFADLHFEEGWYMWLQSRDLLAGLPAPGVEVYCLYGVGLPTPRTYIYDHGFPYTDPVGVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTLEHINAILL 395
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394 
                                                                                                                                                                                                                                          229|                                                                                                                                                       
                                                                                                                                                                                                                                           244                                                                                                                                                       

Chain L from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .................eeee....hhhhh..eeeee......eeeee............eeeeee..eeeeee.........eeeeee.......ee...ee.............eee..hhhhh....eeeeeeeeee....eeeeeee..ee..........eee...eeeeeeeeeehhhhh.....eeeeeee..eeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4xx1 L   1 SYELTQPPSVSVSPGQTASITCSGDKLGNKFTSWYQRKPGQSPVLVIYQDTKRPSGIPERFSGSTSGNTATLTISGTQAMDEADYYCQAWDSSTAWVFGGGTKLEVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT 210
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Chain M from PDB  Type:PROTEIN  Length:124
                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............................eeeeee......eeeeee................eeeee......eeeee........eee..ee.....................eee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xx1 M   3 QLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKFYEDSVKGRFTISRDNSKNTLYLQMDSLRAEDTAVYYCAREGAAVRSFYYSYYGMDVWGQGTTVTVSS 126
                                    12        22        32        42        52        62        72        82        92       102       112       122    

Chain O from PDB  Type:PROTEIN  Length:105
                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...................ee...hhhhh..eeeee.........................eeee..eeee...........eeeeee.......ee...ee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 4xx1 O   2 YELTQPPSVSVSPGQTASITCSGDKLGNKFTSWYQRKPGQSPVLVIYQDTKRPSGIPERFSGSTSGNTATLTISGTQAMDEADYYCQAWDSSTAWVFGGGTKLEV 106
                                    11        21        31        41        51        61        71        81        91       101     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4XX1)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4XX1)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4XX1)

(-) Gene Ontology  (28, 28)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu E:161 - Pro E:162   [ RasMol ]  
    Glu H:161 - Pro H:162   [ RasMol ]  
    Phe A:331 - Pro A:332   [ RasMol ]  
    Phe B:331 - Pro B:332   [ RasMol ]  
    Phe E:159 - Pro E:160   [ RasMol ]  
    Phe H:159 - Pro H:160   [ RasMol ]  
    Phe J:331 - Pro J:332   [ RasMol ]  
    Trp A:61 - Leu A:62   [ RasMol ]  
    Trp B:61 - Leu B:62   [ RasMol ]  
    Trp J:61 - Leu J:62   [ RasMol ]  
    Tyr G:141 - Pro G:142   [ RasMol ]  
    Tyr L:141 - Pro L:142   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4xx1
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LCAT_HUMAN | P04180
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.43
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  LCAT_HUMAN | P04180
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LCAT_HUMAN | P041804x96 4xwg 5bv7

(-) Related Entries Specified in the PDB File

4xwg THIS IS A LOW RESOLUTION STRUCTURE OF THE WILD TYPE LCAT PROTEIN. 4XWG IS A HIGHER RESOLUTION STRUCTURE WITH A SINGLE POINT MUTATION IN LCAT (C31Y).