Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  INSULIN-LIKE GROWTH FACTOR I IN COMPLEX WITH SITE 1 OF A HYBRID INSULIN RECEPTOR / TYPE 1 INSULIN-LIKE GROWTH FACTOR RECEPTOR
 
Authors :  C. Lawrence, G. K. -W. Kong, J. G. Menting, M. C. Lawrence
Date :  22 Jan 15  (Deposition) - 10 Jun 15  (Release) - 22 Jul 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym. Unit :  B,E,F
Biol. Unit 1:  B,E,F  (1x)
Biol. Unit 2:  B,E,F  (6x)
Keywords :  Cell Surface Receptor/Immune System, Insulin Receptor, Ct Peptide, Insulin-Like Growth Factor Receptor, Hormone Receptor-Hormone-Immune System Complex, Hormone-Hormone Receptor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. G. Menting, C. F. Lawrence, G. K. Kong, M. B. Margetts, C. W. Ward, M. C. Lawrence
Structural Congruency Of Ligand Binding To The Insulin And Insulin/Type 1 Insulin-Like Growth Factor Hybrid Receptors.
Structure V. 23 1271 2015
PubMed-ID: 26027733  |  Reference-DOI: 10.1016/J.STR.2015.04.016
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - INSULIN-LIKE GROWTH FACTOR I
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentUNP RESIDUES 49-118
    GeneIGF1, IBP1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymIGF-I,MECHANO GROWTH FACTOR,MGF,SOMATOMEDIN-C
 
Molecule 2 - INSULIN RECEPTOR
    ChainsE
    EC Number2.7.10.1
    EngineeredYES
    Expression SystemCRICETULUS GRISEUS
    Expression System Cell LineLEC 8 MUTANT CHO CELL
    Expression System Taxid10029
    FragmentL1-CR, UNP RESIDUES 28-377
    GeneINSR
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymIR
 
Molecule 3 - INSULIN-LIKE GROWTH FACTOR RECEPTOR ALPHA-CT PEPTIDE
    ChainsF
    EngineeredYES
    FragmentALPHA-CT PEPTIDE, UNP RESIDUES 691-706
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsCHEMICAL SYNTHESIS
    SyntheticYES

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit BEF
Biological Unit 1 (1x)BEF
Biological Unit 2 (6x)BEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 12)

Asymmetric Unit (4, 12)
No.NameCountTypeFull Name
1BMA1Ligand/IonBETA-D-MANNOSE
2FUC2Ligand/IonALPHA-L-FUCOSE
3NAG8Ligand/IonN-ACETYL-D-GLUCOSAMINE
4SO41Ligand/IonSULFATE ION
Biological Unit 1 (4, 12)
No.NameCountTypeFull Name
1BMA1Ligand/IonBETA-D-MANNOSE
2FUC2Ligand/IonALPHA-L-FUCOSE
3NAG8Ligand/IonN-ACETYL-D-GLUCOSAMINE
4SO41Ligand/IonSULFATE ION
Biological Unit 2 (4, 72)
No.NameCountTypeFull Name
1BMA6Ligand/IonBETA-D-MANNOSE
2FUC12Ligand/IonALPHA-L-FUCOSE
3NAG48Ligand/IonN-ACETYL-D-GLUCOSAMINE
4SO46Ligand/IonSULFATE ION

(-) Sites  (7, 7)

Asymmetric Unit (7, 7)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG E:135 , THR E:172 , VAL E:173binding site for residue SO4 E 401
2AC2SOFTWAREASN E:16 , THR E:18binding site for Mono-Saccharide NAG E 402 bound to ASN E 16
3AC3SOFTWAREGLU E:24 , ASN E:25binding site for Poly-Saccharide residues NAG E 403 through FUC E 406 bound to ASN E 25
4AC4SOFTWAREASN E:111 , THR E:113 , SER E:134 , ARG E:135 , ASP E:138 , LEU E:213 , ARG E:229binding site for Mono-Saccharide NAG E 407 bound to ASN E 111
5AC5SOFTWAREASN E:108 , LYS E:190 , ASN E:215 , VAL E:226binding site for Mono-Saccharide NAG E 408 bound to ASN E 215
6AC6SOFTWAREASP E:234 , ARG E:252 , ASN E:255 , ASP E:261binding site for Poly-Saccharide residues NAG E 409 through FUC E 411 bound to ASN E 255
7AC7SOFTWAREASN E:295binding site for Mono-Saccharide NAG E 412 bound to ASN E 295

(-) SS Bonds  (17, 17)

Asymmetric Unit
No.Residues
1B:6 -B:48
2B:18 -B:61
3B:47 -B:52
4E:8 -E:26
5E:126 -E:155
6E:159 -E:182
7E:169 -E:188
8E:192 -E:201
9E:196 -E:207
10E:208 -E:216
11E:212 -E:225
12E:228 -E:237
13E:241 -E:253
14E:259 -E:284
15E:266 -E:274
16E:288 -E:301
17E:304 -E:308

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Pro E:243 -Pro E:244

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4XSS)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4XSS)

(-) Exons   (0, 0)

(no "Exon" information available for 4XSS)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain B from PDB  Type:PROTEIN  Length:47
                                                                               
               SCOP domains ----------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhh.....hhhhhhh....hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------- PROSITE
                 Transcript ----------------------------------------------- Transcript
                 4xss B   3 ETLCGAELVDALQFVCGDRGFYFNTGIVDECCFRSCDLRRLEMYCAP  63
                                    12        22   ||   46        56       
                                                  26|                      
                                                   41                      

Chain E from PDB  Type:PROTEIN  Length:309
                                                                                                                                                                                                                                                                                                                                                     
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeeee..hhhhhhhh.eeeeeeeeeeeee...hhhhhh........ee...eeeeee..............ee........eeeeee..............ee...eeeeeee.........hhhhh.......eeeee.hhh..................eeee..eeee.eee..ee....hhhhhhhh..............................ee....ee......eeee...eeeehhhhhhhhh.............eee..eee......eee......eee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xss E   1 HLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNHIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCP 309
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300         

Chain F from PDB  Type:PROTEIN  Length:12
                                            
               SCOP domains ------------ SCOP domains
               CATH domains ------------ CATH domains
               Pfam domains ------------ Pfam domains
         Sec.struct. author .hhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------ SAPs(SNPs)
                    PROSITE ------------ PROSITE
                 Transcript ------------ Transcript
                 4xss F 693 ENFLHNSIFVPR 704
                                   702  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4XSS)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4XSS)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4XSS)

(-) Gene Ontology  (192, 245)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FUC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Pro E:243 - Pro E:244   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4xss
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IGF1R_HUMAN | P08069
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  IGF1_HUMAN | P05019
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  INSR_HUMAN | P06213
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.10.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  IGF1R_HUMAN | P08069
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  IGF1_HUMAN | P05019
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  INSR_HUMAN | P06213
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IGF1R_HUMAN | P080691igr 1jqh 1k3a 1m7n 1p4o 2oj9 2zm3 3d94 3f5p 3i81 3lvp 3lw0 3nw5 3nw6 3nw7 3o23 3qqu 4d2r 5fxq 5fxr 5fxs 5hzn
        IGF1_HUMAN | P050191b9g 1bqt 1gf1 1gzr 1gzy 1gzz 1h02 1h59 1imx 1pmx 1tgr 1wqj 2dsp 2dsq 2dsr 2gf1 3gf1 3lri
        INSR_HUMAN | P062131gag 1i44 1ir3 1irk 1p14 1rqq 2auh 2b4s 2hr7 2mfr 2z8c 3bu3 3bu5 3bu6 3ekk 3ekn 3eta 3w11 3w12 3w13 3w14 4ibm 4oga 4xlv 4xst 4zxb 5e1s 5hhw 5j3h

(-) Related Entries Specified in the PDB File

3w11 3w12 3w13 3w14 4oga 4xst