Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  HETERODIMERIC COMPLEX OF TRANSCRIPTION FACTORS MEIS1 AND DLX3 ON SPECIFIC DNA
 
Authors :  A. Jorma, Y. Yin, K. R. Nitta, K. Dave, M. Enge, T. Kivioja, A. Popov, E. Mo J. Taipale
Date :  21 Jan 15  (Deposition) - 04 Nov 15  (Release) - 02 Dec 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.50
Chains :  Asym. Unit :  A,B,D,E,G,I,L,M
Biol. Unit 1:  A,G,L,M  (1x)
Biol. Unit 2:  B,D,E,I  (1x)
Keywords :  Transcription, Heterodimer, Dna (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Jolma, Y. Yin, K. R. Nitta, K. Dave, A. Popov, M. Taipale, M. Enge, T. Kivioja, E. Morgunova, J. Taipale
Dna-Dependent Formation Of Transcription Factor Pairs Alter Their Binding Specificity.
Nature V. 527 384 2015
PubMed-ID: 26550823  |  Reference-DOI: 10.1038/NATURE15518

(-) Compounds

Molecule 1 - DNA (5'-D(P*CP*AP*AP*TP*TP*AP*TP*CP*CP*TP*GP*TP*CP*AP*A)- 3')
    ChainsM
    EngineeredYES
    Organism ScientificSYNTHETIC CONSTRUCT
    Organism Taxid32630
    SyntheticYES
 
Molecule 2 - DNA (5'- D(P*AP*CP*AP*AP*TP*TP*AP*TP*CP*CP*TP*GP*TP*CP*AP*AP*C)-3')
    ChainsD
    EngineeredYES
    Organism ScientificSYNTHETIC CONSTRUCT
    Organism Taxid32630
    SyntheticYES
 
Molecule 3 - DNA (5'- D(P*GP*TP*TP*GP*AP*CP*AP*GP*GP*AP*TP*AP*AP*TP*TP*GP*TP*T)-3')
    ChainsE
    EngineeredYES
    Organism ScientificSYNTHETIC CONSTRUCT
    Organism Taxid32630
    SyntheticYES
 
Molecule 4 - DNA (5'- D(P*TP*TP*GP*AP*CP*AP*GP*GP*AP*TP*AP*AP*TP*TP*GP*T)-3')
    ChainsL
    EngineeredYES
    Organism ScientificSYNTHETIC CONSTRUCT
    Organism Taxid32630
    SyntheticYES
 
Molecule 5 - HOMEOBOX PROTEIN MEIS1
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System Cell LineROSETTA
    Expression System PlasmidPETG20A
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 283-340
    GeneMEIS1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
 
Molecule 6 - HOMEOBOX PROTEIN DLX-3
    ChainsG, I
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System Cell LineROSETTA
    Expression System PlasmidPETG20A
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneDLX3
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit ABDEGILM
Biological Unit 1 (1x)A   G LM
Biological Unit 2 (1x) BDE I  

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4XRS)

(-) Sites  (0, 0)

(no "Site" information available for 4XRS)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4XRS)

(-) Cis Peptide Bonds  (8, 8)

Asymmetric Unit
No.Residues
1Lys G:131 -Pro G:132
2Tyr G:136 -Ser G:137
3Tyr G:139 -Gln G:140
4Ser G:182 -Lys G:183
5Lys I:131 -Pro I:132
6Tyr I:136 -Ser I:137
7Tyr I:139 -Gln I:140
8Phe I:184 -Lys I:185

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4XRS)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4XRS)

(-) Exons   (0, 0)

(no "Exon" information available for 4XRS)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:56
                                                                                        
               SCOP domains -------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhh............hhhhhhhh....hhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                 4xrs A 280 PKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 335
                                   289       299       309       319       329      

Chain B from PDB  Type:PROTEIN  Length:58
                                                                                          
               SCOP domains ---------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhh.....hhhhhhhhhh........hhhhhh......hhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------- Transcript
                 4xrs B 279 FPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMID 336
                                   288       298       308       318       328        

Chain D from PDB  Type:DNA  Length:17
                                                 
                 4xrs D  20 ACAATTATCCTGTCAAC  36
                                    29       

Chain E from PDB  Type:DNA  Length:18
                                                  
                 4xrs E   1 GTTGACAGGATAATTGTT  18
                                    10        

Chain G from PDB  Type:PROTEIN  Length:56
                                                                                        
               SCOP domains -------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhhhhh......hhhhhhh.....hhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                 4xrs G 131 KPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKK 186
                                   140       150       160       170       180      

Chain I from PDB  Type:PROTEIN  Length:56
                                                                                        
               SCOP domains -------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhh.....hhhhhhhhh.....hhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                 4xrs I 131 KPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKK 186
                                   140       150       160       170       180      

Chain L from PDB  Type:DNA  Length:16
                                                
                 4xrs L   2 TTGACAGGATAATTGT  17
                                    11      

Chain M from PDB  Type:DNA  Length:15
                                               
                 4xrs M  21 CAATTATCCTGTCAA  35
                                    30     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4XRS)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4XRS)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4XRS)

(-) Gene Ontology  (29, 38)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4xrs)
 
  Sites
(no "Sites" information available for 4xrs)
 
  Cis Peptide Bonds
    Lys G:131 - Pro G:132   [ RasMol ]  
    Lys I:131 - Pro I:132   [ RasMol ]  
    Phe I:184 - Lys I:185   [ RasMol ]  
    Ser G:182 - Lys G:183   [ RasMol ]  
    Tyr G:136 - Ser G:137   [ RasMol ]  
    Tyr G:139 - Gln G:140   [ RasMol ]  
    Tyr I:136 - Ser I:137   [ RasMol ]  
    Tyr I:139 - Gln I:140   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4xrs
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DLX3_HUMAN | O60479
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  MEIS1_HUMAN | O00470
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  DLX3_HUMAN | O60479
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  MEIS1_HUMAN | O00470
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MEIS1_HUMAN | O004705ego

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4XRS)