Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  HUMAN FIBROBLAST GROWTH FACTOR - 1 (FGF-1) MUTANT S116R
 
Authors :  X. Xia
Date :  12 Jan 15  (Deposition) - 20 Jan 16  (Release) - 24 May 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Fibroblast Growth Factor Fgf-1 Increased Heparin Binding Affinity, Growth Factor (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  X. Xia
Biophysical Characterizations Of Fibroblast Growth Factor - 1 Mutant With Increased Heparin Binding Affinity
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - FIBROBLAST GROWTH FACTOR 1
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET21A(+)
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    GeneFGF1, FGFA
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymFGF-1,ACIDIC FIBROBLAST GROWTH FACTOR,AFGF,ENDOTHELIAL CELL GROWTH FACTOR,ECGF,HEPARIN-BINDING GROWTH FACTOR 1,HBGF-1

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 12)

Asymmetric Unit (4, 12)
No.NameCountTypeFull Name
12PE1Ligand/IonNONAETHYLENE GLYCOL
2GOL1Ligand/IonGLYCEROL
3PO48Ligand/IonPHOSPHATE ION
4SO42Ligand/IonSULFATE ION
Biological Unit 1 (3, 6)
No.NameCountTypeFull Name
12PE-1Ligand/IonNONAETHYLENE GLYCOL
2GOL1Ligand/IonGLYCEROL
3PO43Ligand/IonPHOSPHATE ION
4SO42Ligand/IonSULFATE ION
Biological Unit 2 (2, 6)
No.NameCountTypeFull Name
12PE1Ligand/IonNONAETHYLENE GLYCOL
2GOL-1Ligand/IonGLYCEROL
3PO45Ligand/IonPHOSPHATE ION
4SO4-1Ligand/IonSULFATE ION

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASN A:18 , LYS A:112 , LYS A:113 , LYS A:118 , HOH A:346 , HOH A:393 , ASP B:70binding site for residue SO4 A 201
02AC2SOFTWAREHIS A:1E , HIS A:1F , TYR A:125 , HOH A:326 , HIS B:1E , HIS B:1F , TYR B:125 , HOH B:335binding site for residue SO4 A 202
03AC3SOFTWAREASN A:106 , HIS A:124 , TYR A:125 , HOH A:329 , HOH A:336 , HOH A:379 , HIS B:1Dbinding site for residue PO4 A 203
04AC4SOFTWARELYS A:113 , GLN A:127 , LYS A:128 , HOH A:307 , HOH A:346binding site for residue PO4 A 204
05AC5SOFTWARELYS A:112 , HOH A:303 , HOH A:368 , HOH B:315binding site for residue PO4 A 205
06AC6SOFTWAREARG A:35 , ARG A:37 , ARG B:35 , ARG B:37 , HOH B:321binding site for residue GOL A 206
07AC7SOFTWAREHIS A:1D , ASN B:106 , THR B:123 , HIS B:124 , TYR B:125 , HOH B:318 , HOH B:372binding site for residue PO4 B 201
08AC8SOFTWARELYS B:112 , LYS B:118 , ARG B:122 , PO4 B:203 , HOH B:306binding site for residue PO4 B 202
09AC9SOFTWAREASN B:18 , LYS B:112 , LYS B:113 , LYS B:118 , PO4 B:202 , PO4 B:205 , HOH B:308 , HOH B:346binding site for residue PO4 B 203
10AD1SOFTWAREARG A:122 , HIS A:124 , HOH B:339binding site for residue PO4 B 204
11AD2SOFTWARELYS B:113 , LYS B:128 , PO4 B:203 , HOH B:366binding site for residue PO4 B 205
12AD3SOFTWARETYR A:15 , ARG A:35 , ARG A:37 , LEU A:135 , PRO A:136 , SER A:138 , TYR B:15 , ARG B:37 , LEU B:135 , PRO B:136 , SER B:138 , HOH B:317 , HOH B:321binding site for residue 2PE B 206

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4XKI)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4XKI)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4XKI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4XKI)

(-) Exons   (0, 0)

(no "Exon" information available for 4XKI)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:145
                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................eeeee....eeeee.....eeee.........eeeee....eeeeee.....eeee.....eeee...hhhh.eeeeee...eeeeee..hhhhh............hhhhh...hhhh.eeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xki A   0 MHHHHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGRCKRGPRTHYGQKAILFLPLPVS 138
                             ||||||| 3        13        23        33        43        53        63        73        83        93       103       113       123       133     
                             |||||||                                                                                                                                         
                            1A||||||                                                                                                                                         
                             1B|||||                                                                                                                                         
                              1C||||                                                                                                                                         
                               1D|||                                                                                                                                         
                                1E||                                                                                                                                         
                                 1F|                                                                                                                                         
                                  1G                                                                                                                                         

Chain B from PDB  Type:PROTEIN  Length:144
                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .................eeeee....eeeee.....eeee.........eeeee....eeeeee.....eeee.....eeee...hhhh.eeeeee...eeeeee..hhhhh............hhhhh...hhhh.eeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4xki B  1A HHHHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGRCKRGPRTHYGQKAILFLPLPVS 138
                            |||||||  4        14        24        34        44        54        64        74        84        94       104       114       124       134    
                           1A||||||                                                                                                                                         
                            1B|||||                                                                                                                                         
                             1C||||                                                                                                                                         
                              1D|||                                                                                                                                         
                               1E||                                                                                                                                         
                                1F|                                                                                                                                         
                                 1G                                                                                                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4XKI)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4XKI)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4XKI)

(-) Gene Ontology  (57, 57)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2PE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4xki)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4xki
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FGF1_HUMAN | P05230
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FGF1_HUMAN | P05230
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FGF1_HUMAN | P052301axm 1djs 1dzc 1dzd 1e0o 1evt 1hkn 1jqz 1jt3 1jt4 1jt5 1jt7 1jtc 1jy0 1k5u 1k5v 1m16 1nzk 1p63 1pzz 1q03 1q04 1qct 1rg8 1rml 1ry7 1yto 1z2v 1z4s 2afg 2aqz 2axm 2erm 2hw9 2hwa 2hwm 2hz9 2k43 2k4a 2k8r 2ki4 2ki6 2ntd 2q9x 2rq9 3b9u 3ba4 3ba5 3ba7 3bad 3bag 3bah 3bao 3baq 3bau 3bav 3bb2 3cqa 3crg 3crh 3cri 3cu1 3fgm 3fj8 3fj9 3fja 3fjb 3fjc 3fjd 3fje 3fjf 3fjh 3fji 3fjj 3fjk 3hom 3jut 3k1x 3o3q 3oj2 3ojm 3ojv 3ud7 3ud8 3ud9 3uda 4j23 4q91 4q9g 4q9p 4qal 4qbc 4qbv 4qc4 4qo3 4yol

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4XKI)