Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF HUMAN ALDH1A1 WITH INHIBITOR CM037
 
Authors :  C. A. Morgan, T. D. Hurley
Date :  03 Dec 14  (Deposition) - 11 Feb 15  (Release) - 11 Mar 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.85
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (4x)
Keywords :  Oxidoreductase Enzyme Inhibitor, Oxidoreductase-Oxidoreductase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. A. Morgan, T. D. Hurley
Characterization Of Two Distinct Structural Classes Of Selective Aldehyde Dehydrogenase 1A1 Inhibitors.
J. Med. Chem. V. 58 1964 2015
PubMed-ID: 25634381  |  Reference-DOI: 10.1021/JM501900S

(-) Compounds

Molecule 1 - RETINAL DEHYDROGENASE 1
    ChainsA
    EC Number1.2.1.36
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneALDH1A1, ALDC, ALDH1, PUMB1
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymRALDH1,ALDH-E1,ALHDII,ALDEHYDE DEHYDROGENASE FAMILY 1 MEMBER A1,ALDEHYDE DEHYDROGENASE,CYTOSOLIC

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (4x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 9)

Asymmetric Unit (5, 9)
No.NameCountTypeFull Name
13XG1Ligand/IonETHYL ({4-OXO-3-[3-(PYRROLIDIN-1-YL)PROPYL]-3,4-DIHYDRO[1]BENZOTHIENO[3,2-D]PYRIMIDIN-2-YL}SULFANYL)ACETATE
2CL4Ligand/IonCHLORIDE ION
3NA1Ligand/IonSODIUM ION
4NAI1Ligand/Ion1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE
5YB2Ligand/IonYTTERBIUM (III) ION
Biological Unit 1 (2, 8)
No.NameCountTypeFull Name
13XG4Ligand/IonETHYL ({4-OXO-3-[3-(PYRROLIDIN-1-YL)PROPYL]-3,4-DIHYDRO[1]BENZOTHIENO[3,2-D]PYRIMIDIN-2-YL}SULFANYL)ACETATE
2CL-1Ligand/IonCHLORIDE ION
3NA-1Ligand/IonSODIUM ION
4NAI4Ligand/Ion1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE
5YB-1Ligand/IonYTTERBIUM (III) ION

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHOH A:741 , HOH A:772 , HOH A:775 , HOH A:777 , HOH A:778 , HOH A:779 , HOH A:780binding site for residue YB A 601
2AC2SOFTWARECL A:605 , CL A:606 , CL A:607 , NAI A:608 , HOH A:845 , HOH A:861binding site for residue YB A 602
3AC3SOFTWARESER A:121 , GLY A:125 , MET A:175 , TRP A:178 , TYR A:297 , ILE A:304 , GLY A:458 , PHE A:466binding site for residue 3XG A 603
4AC4SOFTWAREARG A:143 , THR A:155 , HIS A:157binding site for residue CL A 604
5AC5SOFTWAREGLU A:349 , YB A:602 , CL A:606 , CL A:607 , NAI A:608 , HOH A:845 , HOH A:861binding site for residue CL A 605
6AC6SOFTWAREYB A:602 , CL A:605 , CL A:607 , HOH A:845 , HOH A:861binding site for residue CL A 606
7AC7SOFTWAREGLU A:349 , YB A:602 , CL A:605 , CL A:606 , HOH A:845 , HOH A:861binding site for residue CL A 607
8AC8SOFTWAREILE A:166 , ILE A:167 , PRO A:168 , TRP A:169 , ASN A:170 , LYS A:193 , ALA A:195 , GLU A:196 , GLY A:226 , GLY A:230 , ALA A:231 , PHE A:244 , THR A:245 , GLY A:246 , SER A:247 , VAL A:250 , GLU A:269 , GLY A:271 , CYS A:303 , GLU A:349 , GLN A:350 , LYS A:353 , GLU A:400 , PHE A:402 , YB A:602 , CL A:605 , HOH A:807 , HOH A:861binding site for residue NAI A 608

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4X4L)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4X4L)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4X4L)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4X4L)

(-) Exons   (0, 0)

(no "Exon" information available for 4X4L)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:493
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eee..eee......eeeee......eeeeee..hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh...ee.....eeeeeeeee..eeeee....hhhhhhhhhhhhhhhh..eeeee.....hhhhhhhhhhhhhhh.....eee......hhhhhhhh.....eeeee.hhhhhhhhhhhhhhh...eeeee.....eeee....hhhhhhhhhhhhhhhhhhh......eeeeehhhhhhhhhhhhhhhh..................hhhhhhhhhhhhhhhhhh..eeee...ee.....ee..eeee.....hhhhhh.....eeeeeee.hhhhhhhhhhh.....eeeee..hhhhhhhhhhhh...eeee..............hhh.ee...hhhhhhhh.eeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4x4l A   9 LPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLSDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS 501
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4X4L)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4X4L)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4X4L)

(-) Gene Ontology  (17, 17)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    3XG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    YB  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4x4l)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4x4l
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AL1A1_HUMAN | P00352
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.2.1.36
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  AL1A1_HUMAN | P00352
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        AL1A1_HUMAN | P003524wb9 4wj9 4wp7 4wpn 5ac2 5l2m 5l2n 5l2o

(-) Related Entries Specified in the PDB File

4wp7 4WP7 CONTAINS THE SAME PROTEIN COMPLEXED WITH A DIFFERENT INHIBITOR