Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF SUMO1 IN COMPLEX WITH PML
 
Authors :  L. Cappadocia, X. H. Mascle, V. Bourdeau, S. Tremblay-Belzile, M. Chak Margot, M. Lussier-Price, J. Wada, K. Sakaguchi, M. Aubry, G. Ferbeyr J. G. Omichinski
Date :  01 Oct 14  (Deposition) - 31 Dec 14  (Release) - 25 Feb 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.46
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Sumo1, Pml, Sumo Interaction Motif, Phosphosim (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Cappadocia, X. H. Mascle, V. Bourdeau, S. Tremblay-Belzile, M. Chaker-Margot, M. Lussier-Price, J. Wada, K. Sakaguchi, M. Aubry, G. Ferbeyre, J. G. Omichinski
Structural And Functional Characterization Of The Phosphorylation-Dependent Interaction Between Pml And Sumo1
Structure V. 23 126 2015
PubMed-ID: 25497731  |  Reference-DOI: 10.1016/J.STR.2014.10.015

(-) Compounds

Molecule 1 - SMALL UBIQUITIN-RELATED MODIFIER 1
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPGEX2T
    Expression System StrainTOPP2
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentSUMO1, UNP RESIDUES 17-97
    GeneSUMO1, SMT3C, SMT3H3, UBL1, OK/SW-CL.43
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymSUMO-1,GAP-MODIFYING PROTEIN 1,GMP1,SMT3 HOMOLOG 3,SENTRIN, UBIQUITIN-HOMOLOGY DOMAIN PROTEIN PIC1,UBIQUITIN-LIKE PROTEIN SMT3C, SMT3C,UBIQUITIN-LIKE PROTEIN UBL1
 
Molecule 2 - PROTEIN PML
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPGEX2T
    Expression System StrainTOPP2
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentPML, UNP RESIDUES 547-573
    GenePML, MYL, PP8675, RNF71, TRIM19
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPROMYELOCYTIC LEUKEMIA PROTEIN,RING FINGER PROTEIN 71, TRIPARTITE MOTIF-CONTAINING PROTEIN 19

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4WJO)

(-) Sites  (0, 0)

(no "Site" information available for 4WJO)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4WJO)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Glu A:93 -Gln A:94

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4WJO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4WJO)

(-) Exons   (0, 0)

(no "Exon" information available for 4WJO)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:77
                                                                                                            
               SCOP domains ----------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee.....eeeeee.....hhhhhhhhhhhhh.hhh.eeeee..ee.....hhhhhh.....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------- Transcript
                  4wjo A 18 EGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ 94
                                    27        37        47        57        67        77        87       

Chain B from PDB  Type:PROTEIN  Length:15
                                              
               SCOP domains --------------- SCOP domains
               CATH domains --------------- CATH domains
               Pfam domains --------------- Pfam domains
         Sec.struct. author ....eee........ Sec.struct. author
                 SAPs(SNPs) --------------- SAPs(SNPs)
                    PROSITE --------------- PROSITE
                 Transcript --------------- Transcript
                  4wjo B  7 AEERVVVISNSSSRY 29
                                    24     
                                   15|     
                                    24     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4WJO)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4WJO)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4WJO)

(-) Gene Ontology  (128, 143)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4wjo)
 
  Sites
(no "Sites" information available for 4wjo)
 
  Cis Peptide Bonds
    Glu A:93 - Gln A:94   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4wjo
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PML_HUMAN | P29590
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SUMO1_HUMAN | P63165
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PML_HUMAN | P29590
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SUMO1_HUMAN | P63165
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PML_HUMAN | P295901bor 2mvw 2mwx 4wjn
        SUMO1_HUMAN | P631651a5r 1tgz 1wyw 1y8r 1z5s 2asq 2bf8 2g4d 2io2 2iy0 2iy1 2kqs 2las 2mw5 2n1a 2n1v 2pe6 2uyz 2vrr 3kyc 3kyd 3rzw 3uip 4wjn 4wjp 4wjq 5aek 5b7a 5elj 5ghd

(-) Related Entries Specified in the PDB File

4wjn 4wjp 4wjq