Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  ELECTRON CRYO-MICROSCOPY STRUCTURE OF PB1-P62 TYPE T FILAMENTS
 
Authors :  R. Ciuffa, T. Lamark, A. Tarafder, A. Guesdon, S. Rybina, W. J. H. Hagen, T. Johansen, C. Sachse
Date :  15 Mar 15  (Deposition) - 13 May 15  (Release) - 27 May 15  (Revision)
Method :  ELECTRON MICROSCOPY
Resolution :  10.30
Chains :  Asym. Unit :  A,B,D
Biol. Unit 1:  A,B,D  (20x)
Keywords :  Signaling Protein, Selective Autophagy, Autophagy Receptor, Autophagy Scaffold, P62/Sqstm1, Single-Particle Helical Reconstruction (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. Ciuffa, T. Lamark, A. K. Tarafder, A. Guesdon, S. Rybina, W. J. H. Hagen, T. Johansen, C. Sachse
The Selective Autophagy Receptor P62 Forms A Flexible Filamentous Helical Scaffold.
Cell Rep. V. 11 748 2015
PubMed-ID: 25921531  |  Reference-DOI: 10.1016/J.CELREP.2015.03.062

(-) Compounds

Molecule 1 - SEQUESTOSOME-1
    ChainsA, B, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPOPTM-P62-PB1
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    FragmentPB1 DOMAIN, RESIDUES 1-122
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymEBI3-ASSOCIATED PROTEIN OF 60 KDA, EBIAP, P60, PHOSPHOTYROSINE-INDEPENDENT LIGAND FOR THE LCK SH2 DOMAIN OF 62 KDA, UBIQUITIN-BINDING PROTEIN P62

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABD
Biological Unit 1 (20x)ABD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4UF9)

(-) Sites  (0, 0)

(no "Site" information available for 4UF9)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4UF9)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4UF9)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4UF9)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4UF9)

(-) Exons   (0, 0)

(no "Exon" information available for 4UF9)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:101
                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee.....eeeeeeeee................hhhhhhhhhhhhhh.......eeeeee.....eeee.hhhhhhhhhhhh...eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                 4uf9 A   3 SLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKK 103
                                    12        22        32        42        52        62        72        82        92       102 

Chain B from PDB  Type:PROTEIN  Length:101
                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee.....eeeeeeeee................hhhhhhhhhhhhhh.......eeeeee.....eeee.hhhhhhhhhhhh...eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                 4uf9 B   3 SLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKK 103
                                    12        22        32        42        52        62        72        82        92       102 

Chain D from PDB  Type:PROTEIN  Length:101
                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee.....eeeeeeeee................hhhhhhhhhhhhhh.......eeeeee.....eeee.hhhhhhhhhhhh...eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                 4uf9 D   3 SLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKK 103
                                    12        22        32        42        52        62        72        82        92       102 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4UF9)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4UF9)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4UF9)

(-) Gene Ontology  (56, 56)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4uf9)
 
  Sites
(no "Sites" information available for 4uf9)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4uf9)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4uf9
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SQSTM_HUMAN | Q13501
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SQSTM_HUMAN | Q13501
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SQSTM_HUMAN | Q135011q02 2jy7 2jy8 2k0b 2knv 4mjs 4uf8

(-) Related Entries Specified in the PDB File

4uf8 ELECTRON CRYO-MICROSCOPY STRUCTURE OF PB1-P62 TYPE T FILAMENTS RELATED ID: EMD-2937 RELATED DB: EMDB