Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  ITK KINASE DOMAIN IN COMPLEX WITH INHIBITOR COMPOUND
 
Authors :  P. A. Mcewan, J. J. Barker, C. Eigenbrot
Date :  13 May 14  (Deposition) - 14 Jan 15  (Release) - 14 Jan 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.45
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Protein Kinase, Phosphotransfer Catalyst, Transferase-Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. Trani, J. J. Barker, S. M. Bromidge, F. A. Brookfield, J. D. Burch, Y. Chen, C. Eigenbrot, A. Heifetz, M. H. Ismaili, A. Johnson, T. M. Krulle, C. H. Mackinnon, R. Maghames, P. A. Mcewan, C. A. Montalbetti, D. F. Ortwine, Y. Perez-Fuertes, D. G. Vaidya, X. Wang, A. A. Zarrin, Z. Pei
Design, Synthesis And Structure-Activity Relationships Of A Novel Class Of Sulfonylpyridine Inhibitors Of Interleukin-2 Inducible T-Cell Kinase (Itk).
Bioorg. Med. Chem. Lett. V. 24 5818 2014
PubMed-ID: 25455497  |  Reference-DOI: 10.1016/J.BMCL.2014.10.020

(-) Compounds

Molecule 1 - TYROSINE-PROTEIN KINASE ITK/TSK
    Chains: A, B
    EC Number: 2.7.10.2
    Engineered: YES
    Expression System: SPODOPTERA FRUGIPERDA
    Expression System Taxid: 7108
    Fragment: UNP RESIDUES 357-620
    Gene: ITK, EMT, LYK
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: INTERLEUKIN-2-INDUCIBLE T-CELL KINASE, IL-2-INDUCIBLE T-CELL KINASE, KINASE EMT, T-CELL-SPECIFIC KINASE, TYROSINE-PROTEIN KINASE LYK

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
130T2Ligand/IonTRANS-4-({6-[(5-PHENYL-1H-PYRAZOL-3-YL)AMINO]-4-(PHENYLSULFONYL)PYRIDIN-2-YL}AMINO)CYCLOHEXANOL
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
130T1Ligand/IonTRANS-4-({6-[(5-PHENYL-1H-PYRAZOL-3-YL)AMINO]-4-(PHENYLSULFONYL)PYRIDIN-2-YL}AMINO)CYCLOHEXANOL
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
130T1Ligand/IonTRANS-4-({6-[(5-PHENYL-1H-PYRAZOL-3-YL)AMINO]-4-(PHENYLSULFONYL)PYRIDIN-2-YL}AMINO)CYCLOHEXANOL

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREALA A:389 , VAL A:419 , PHE A:435 , GLU A:436 , PHE A:437 , MET A:438 , GLU A:439 , HIS A:440 , GLY A:441 , LEU A:489 , HOH A:801 , HOH A:804 , ILE B:369BINDING SITE FOR RESIDUE 30T A 701
2AC2SOFTWAREILE A:369 , VAL A:377 , ALA B:389 , PHE B:435 , GLU B:436 , PHE B:437 , MET B:438 , GLU B:439 , HIS B:440 , GLY B:441 , LEU B:489 , HOH B:801BINDING SITE FOR RESIDUE 30T B 701

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4QD6)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Met A:503 -Thr A:504

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4QD6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4QD6)

(-) Exons   (0, 0)

(no "Exon" information available for 4QD6)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:244
                                                                                                                                                                                                                                                                                    
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhh.eeeeeeeee....eeeeeeee..eeeeeee....hhhhhhhhhhhh.......eeeee......eeeee.....hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.hhh.eee......hhhhhhhhhhh....hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4qd6 A 355 GSVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTISEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAESG 619
                                   364       374       384       399       409       419       429       439       449       459       469       479       489       499    || 525       535       545       555       565       575       585       595       605       615    
                                                                393|                                                                                                      504|                                                                                                  
                                                                 399                                                                                                       521                                                                                                  


Chain B from PDB  Type:PROTEIN  Length:243
                                                                                                                                                                                                                                                                                   
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhh.eeeeeeee......eeeeee..eeeeeeeee..hhhhhhhhhhh........eeeee.....eeeeee.....hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.hhh.eee...........hhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhhh.hhhhh.hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4qd6 B 355 GSVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAESG 619
                                   364       374       384       400       410       420       430       440       450       460       470       480       490       500   ||  526       536       546       556       566       576       586       596       606       616   
                                                                393|                                                                                                     504|                                                                                                  
                                                                 400                                                                                                      521
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4QD6)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4QD6)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4QD6)

(-) Gene Ontology  (33, 33)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    30T  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Met A:503 - Thr A:504   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4qd6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ITK_HUMAN | Q08881
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.10.2
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ITK_HUMAN | Q08881
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ITK_HUMAN | Q08881: 1sm2 1snu 1snx 2e6i 2lmj 2yuq 3miy 3mj1 3mj2 3qgw 3qgy 3t9t 3v5j 3v5l 3v8t 3v8w 4hct 4hcu 4hcv 4kio 4l7s 4m0y 4m0z 4m12 4m13 4m14 4m15 4mf0 4mf1 4pp9 4ppa 4ppb 4ppc 4pqn 4rfm

(-) Related Entries Specified in the PDB File

4mf0 4mf1