Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF AN RBX1-UBC12~NEDD8-CUL1-DCN1 COMPLEX: A RING-E3-E2~UBIQUITIN-LIKE PROTEIN-SUBSTRATE INTERMEDIATE TRAPPED IN ACTION
 
Authors :  D. C. Scott, B. A. Schulman
Date :  18 Mar 14  (Deposition) - 02 Jul 14  (Release) - 02 Jul 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.11
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,K
Biol. Unit 1:  A,B,C,D,E,K  (1x)
Biol. Unit 2:  F,G,H,I  (1x)
Keywords :  Nedd8, Cullin, Neddylation, Complex, Ubc12, Dcn1, Ubiquitin, Ligase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. C. Scott, V. O. Sviderskiy, J. K. Monda, J. R. Lydeard, S. E. Cho, J. W. Harper, B. A. Schulman
Structure Of A Ring E3 Trapped In Action Reveals Ligation Mechanism For The Ubiquitin-Like Protein Nedd8.
Cell V. 157 1671 2014
PubMed-ID: 24949976  |  Reference-DOI: 10.1016/J.CELL.2014.04.037

(-) Compounds

Molecule 1 - CULLIN-1
    ChainsA, C
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneCUL1
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCUL-1
 
Molecule 2 - E3 UBIQUITIN-PROTEIN LIGASE RBX1
    ChainsB, D
    EC Number6.3.2.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneRBX1, RNF75, ROC1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPROTEIN ZYP,RING FINGER PROTEIN 75,RING-BOX PROTEIN 1,RBX1, REGULATOR OF CULLINS 1
 
Molecule 3 - DCN1-LIKE PROTEIN 1
    ChainsE, F
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneDCUN1D1, DCUN1L1, RP42, SCCRO
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymDCUN1 DOMAIN-CONTAINING PROTEIN 1,DEFECTIVE IN CULLIN NEDDYLATION PROTEIN 1-LIKE PROTEIN 1,SQUAMOUS CELL CARCINOMA-RELATED ONCOGENE
 
Molecule 4 - NEDD8-CONJUGATING ENZYME UBC12
    ChainsI, G
    EC Number6.3.2.-
    EngineeredYES
    Expression SystemTRICHOPLUSIA NI
    Expression System Taxid7111
    GeneUBE2M, UBC12
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymNEDD8 CARRIER PROTEIN,NEDD8 PROTEIN LIGASE,UBIQUITIN- CONJUGATING ENZYME E2 M
 
Molecule 5 - NEDD8
    ChainsK, H
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneNEDD8
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymNEDDYLIN,NEURAL PRECURSOR CELL EXPRESSED DEVELOPMENTALLY DOWN-REGULATED PROTEIN 8,NEDD-8,UBIQUITIN-LIKE PROTEIN NEDD8

 Structural Features

(-) Chains, Units

  12345678910
Asymmetric Unit ABCDEFGHIK
Biological Unit 1 (1x)ABCDE    K
Biological Unit 2 (1x)     FGHI 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 8)

Asymmetric Unit (2, 8)
No.NameCountTypeFull Name
1AME2Mod. Amino AcidN-ACETYLMETHIONINE
2ZN6Ligand/IonZINC ION
Biological Unit 1 (0, 0)
No.NameCountTypeFull Name
1AME-1Mod. Amino AcidN-ACETYLMETHIONINE
2ZN-1Ligand/IonZINC ION
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1AME2Mod. Amino AcidN-ACETYLMETHIONINE
2ZN-1Ligand/IonZINC ION

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS B:42 , CYS B:45 , HIS B:80 , CYS B:83binding site for residue ZN B 201
2AC2SOFTWARECYS B:75 , HIS B:77 , CYS B:94 , ASP B:97binding site for residue ZN B 202
3AC3SOFTWARECYS B:53 , CYS B:56 , CYS B:68 , HIS B:82binding site for residue ZN B 203
4AC4SOFTWARECYS D:42 , CYS D:45 , HIS D:80 , CYS D:83binding site for residue ZN D 201
5AC5SOFTWARECYS D:75 , HIS D:77 , CYS D:94 , ASP D:97binding site for residue ZN D 202
6AC6SOFTWARECYS D:53 , CYS D:56 , CYS D:68 , HIS D:82binding site for residue ZN D 203
7AC7SOFTWAREPRO F:97 , SER F:99 , VAL F:102 , LEU F:103 , GLN F:114 , CYS F:115 , PHE F:164 , TYR F:181 , LYS G:3 , LEU G:4 , PHE G:5binding site for Di-peptide AME G 1 and ILE G 2
8AC8SOFTWAREVAL G:63 , ILE G:64 , LYS G:75 , VAL G:77 , THR G:97 , VAL G:99 , SER G:103 , VAL G:110 , LEU G:112 , PHE G:136 , GLU G:142 , ASP G:143 , PRO G:144 , LEU G:145 , MET G:168 , GLY H:75binding site for Di-peptide GLY H 76 and SER G 111

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4P5O)

(-) Cis Peptide Bonds  (12, 12)

Asymmetric Unit
No.Residues
1Lys A:417 -Ser A:418
2Ser A:542 -Gly A:543
3Val A:682 -Asn A:683
4Gly E:152 -Arg E:153
5Gln I:31 -Leu I:32
6Tyr I:86 -Pro I:87
7Lys C:417 -Ser C:418
8Ser C:542 -Gly C:543
9Val C:682 -Asn C:683
10Gly F:152 -Arg F:153
11Gln G:31 -Leu G:32
12Tyr G:86 -Pro G:87

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4P5O)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4P5O)

(-) Exons   (0, 0)

(no "Exon" information available for 4P5O)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:327
                                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeeee.................hhhhhhhhhhhhhhhhh..eeeeeeeeeeeeeee........eeeeehhhhhh...hhhhhhhhhh.hhhhhhhhhhhhhh....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhh..eee......eeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4p5o A 416 SKSPEELARYCDSLLKKSSKNPEEAELEDTLNQVMEKFKKIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLYTVQQLTDSTQIKMDILAQVLQILLKSKLPDTLIRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMRMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 776
                                   425       435       445       455       465       475       485       495       505       515       525       535       545       555       565       575       585       595       605      |622       632       642     ||668||     689       699       709       719       729       739       749       759       769       
                                                                                                                                                                                                                              612|                         648| 669|                                                                                               
                                                                                                                                                                                                                               620                          665  681                                                                                               

Chain B from PDB  Type:PROTEIN  Length:75
                                                                                                           
               SCOP domains --------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeee.................hhhhhh....eee.....eeehhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------- Transcript
                 4p5o B  23 EVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQ 104
                                    32        42        52      ||69        79        89        99     
                                                               59|                                     
                                                                67                                     

Chain C from PDB  Type:PROTEIN  Length:322
                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............eee.................hhhhhhhhhhhhhhhhh..eeeeeeeeeeeeee.......eeeehhhhh..hhhhhhhhh..hhhhhhhhhhhhhh....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhh..eee......eeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4p5o C 416 SKSPEELARYCDSLLKKSSKNPEEAELEDTLNQVMEKFKKIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKTLQASTFQMAIYTVQQLTDSTQIKMDILAQVLQILLKSKLLPDTLIVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMRMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 776
                                   425       435       445       455       465       475       485       495       505       515       525       535       545       555       565       575       585       595||     608 ||    627       637       647 ||   |684       694       704       714       724       734       744       754       764       774  
                                                                                                                                                                                                              596|       610|                          649| 669|                                                                                              
                                                                                                                                                                                                               600        620                           665  682                                                                                              

Chain D from PDB  Type:PROTEIN  Length:76
                                                                                                            
               SCOP domains ---------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeee.................hhhhhh....eee.....eeehhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------- Transcript
                 4p5o D  23 EVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQK 105
                                    32        42        52      ||69        79        89        99      
                                                               59|                                      
                                                                67                                      

Chain E from PDB  Type:PROTEIN  Length:197
                                                                                                                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh......eehhhhhhhhhhhh.....hhhhhhhhhhh.......eehhhhhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhhhh..............hhhhhh.....hhhhhhhh.........hhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4p5o E  62 RKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTT 258
                                    71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       

Chain F from PDB  Type:PROTEIN  Length:195
                                                                                                                                                                                                                                   
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhh......eehhhhhhhhhhhh.....hhhhhhhhhhh.......eehhhhhhhhhhh...hhhhhhhhhhhhhh.......hhhhhhhhhhhhh.....ee.......hhhhhh.....hhhhhhhh........eehhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4p5o F  64 KLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTT 258
                                    73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253     

Chain G from PDB  Type:PROTEIN  Length:171
                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh......hhhhhhhh......eeee........eeeeee...........eeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhee....ee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4p5o G   1 xIKLFSLKQQKKEEEAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPSIDLEGNVSLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLKH 184
                            |       10    ||  33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183 
                            1-AME        15|                                                                                                                                                           
                                          29                                                                                                                                                           

Chain H from PDB  Type:PROTEIN  Length:76
                                                                                                            
               SCOP domains ---------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee.....eeeee.....hhhhhhhhhhhhhh......eeee..ee................eeeee...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------- Transcript
                 4p5o H   1 MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG  76
                                    10        20        30        40        50        60        70      

Chain I from PDB  Type:PROTEIN  Length:169
                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh.....hhhhhhhh......eeee........eeeeee...........eeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhee....ee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4p5o I   1 xIKLFSLKQQKKEAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPSIDLEGNVSLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLKH 184
                            |       10  ||    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175         
                            1-AME      13|                                                                                                                                                           
                                        29                                                                                                                                                           

Chain K from PDB  Type:PROTEIN  Length:76
                                                                                                            
               SCOP domains ---------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee.....eeeee......hhhhhhhhhhhhh......eeee..ee................eeeee...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------- Transcript
                 4p5o K   1 MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG  76
                                    10        20        30        40        50        60        70      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4P5O)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4P5O)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4P5O)

(-) Gene Ontology  (83, 123)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    AME  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gln G:31 - Leu G:32   [ RasMol ]  
    Gln I:31 - Leu I:32   [ RasMol ]  
    Gly E:152 - Arg E:153   [ RasMol ]  
    Gly F:152 - Arg F:153   [ RasMol ]  
    Lys A:417 - Ser A:418   [ RasMol ]  
    Lys C:417 - Ser C:418   [ RasMol ]  
    Ser A:542 - Gly A:543   [ RasMol ]  
    Ser C:542 - Gly C:543   [ RasMol ]  
    Tyr G:86 - Pro G:87   [ RasMol ]  
    Tyr I:86 - Pro I:87   [ RasMol ]  
    Val A:682 - Asn A:683   [ RasMol ]  
    Val C:682 - Asn C:683   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4p5o
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CUL1_HUMAN | Q13616
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  DCNL1_HUMAN | Q96GG9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  NEDD8_HUMAN | Q15843
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RBX1_HUMAN | P62877
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UBC12_HUMAN | P61081
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  6.3.2.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CUL1_HUMAN | Q13616
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  DCNL1_HUMAN | Q96GG9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  NEDD8_HUMAN | Q15843
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RBX1_HUMAN | P62877
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  UBC12_HUMAN | P61081
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CUL1_HUMAN | Q136161ldj 1ldk 1u6g 3rtr 3tdu 3tdz 4f52 5v89
        DCNL1_HUMAN | Q96GG93tdu 3tdz 5v83 5v86 5v88
        NEDD8_HUMAN | Q158431ndd 1r4m 1r4n 1xt9 2bkr 2ko3 2n7k 2nvu 3dbh 3dbl 3dbr 3dqv 3gzn 4f8c 4fbj 4hcp
        RBX1_HUMAN | P628771ldj 1ldk 1u6g 2hye 2lgv 3dpl 3dqv 3rtr 4f52 5n4w
        UBC12_HUMAN | P610811tt5 1y8x 2nvu 3tdu 3tdz 4gao

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4P5O)