Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  ALPHAVBETA3 INTEGRIN IN COMPLEX WITH MONOCLONAL ANTIBODY FAB FRAGMENT.
 
Authors :  B. Mahalingam, J. Van Agthoven, J. Xiong, M. A. Arnaout
Date :  13 Dec 13  (Deposition) - 02 Apr 14  (Release) - 25 Feb 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.60
Chains :  Asym./Biol. Unit :  A,B,H,L
Keywords :  Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. Mahalingam, J. F. Van Agthoven, J. P. Xiong, J. L. Alonso, B. D. Adair, X. Rui, S. Anand, M. Mehrbod, M. R. Mofrad, C. Burger, S. L. Goodman, M. A. Arnaout
Atomic Basis For The Species-Specific Inhibition Of Alpha V Integrins By Monoclonal Antibody 17E6 Is Revealed By The Crystal Structure Of Alpha V Beta 3 Ectodomain-17E6 Fab Complex.
J. Biol. Chem. V. 289 13801 2014
PubMed-ID: 24692540  |  Reference-DOI: 10.1074/JBC.M113.546929

(-) Compounds

Molecule 1 - INTEGRIN ALPHA-V
    ChainsA
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Taxid7108
    GeneITGAV, MSK8, VNRA
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymVITRONECTIN RECEPTOR SUBUNIT ALPHA
 
Molecule 2 - INTEGRIN BETA-3
    ChainsB
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Taxid7108
    GeneITGB3, GP3A
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPLATELET MEMBRANE GLYCOPROTEIN IIIA, GPIIIA
 
Molecule 3 - 17E6 LIGHT CHAIN
    ChainsL
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
 
Molecule 4 - 17E6 HEAVY CHAIN
    ChainsH
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABHL

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 37)

Asymmetric/Biological Unit (5, 37)
No.NameCountTypeFull Name
1BMA5Ligand/IonBETA-D-MANNOSE
2MAN8Ligand/IonALPHA-D-MANNOSE
3MN5Ligand/IonMANGANESE (II) ION
4NAG17Ligand/IonN-ACETYL-D-GLUCOSAMINE
5NO32Ligand/IonNITRATE ION

(-) Sites  (37, 37)

Asymmetric Unit (37, 37)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLU A:15 , GLY A:16 , LYS A:42 , ASN A:44 , GLU A:52 , NAG A:1002BINDING SITE FOR RESIDUE NAG A 1001
02AC2SOFTWARENAG A:1001 , BMA A:1003BINDING SITE FOR RESIDUE NAG A 1002
03AC3SOFTWARENAG A:1002 , MAN A:1004 , MAN A:1006BINDING SITE FOR RESIDUE BMA A 1003
04AC4SOFTWAREBMA A:1003 , BMA A:1005BINDING SITE FOR RESIDUE MAN A 1004
05AC5SOFTWAREMAN A:1004 , MAN A:1024BINDING SITE FOR RESIDUE BMA A 1005
06AC6SOFTWAREBMA A:1003BINDING SITE FOR RESIDUE MAN A 1006
07AC7SOFTWAREASP A:257 , ASN A:260 , NAG A:1008BINDING SITE FOR RESIDUE NAG A 1007
08AC8SOFTWARENAG A:1007 , BMA A:1009BINDING SITE FOR RESIDUE NAG A 1008
09AC9SOFTWARENAG A:1008BINDING SITE FOR RESIDUE BMA A 1009
10BC1SOFTWAREPHE A:217 , TYR A:254 , SER A:263 , LEU A:264 , ASN A:266 , NAG A:1011BINDING SITE FOR RESIDUE NAG A 1010
11BC2SOFTWAREPHE A:217 , NAG A:1010 , BMA A:1012BINDING SITE FOR RESIDUE NAG A 1011
12BC3SOFTWAREGLN A:214 , NAG A:1011 , MAN A:1013 , MAN A:1015BINDING SITE FOR RESIDUE BMA A 1012
13BC4SOFTWAREBMA A:1012 , MAN A:1014BINDING SITE FOR RESIDUE MAN A 1013
14BC5SOFTWAREGLN A:214 , MAN A:1013BINDING SITE FOR RESIDUE MAN A 1014
15BC6SOFTWAREBMA A:1012BINDING SITE FOR RESIDUE MAN A 1015
16BC7SOFTWAREASN A:492 , ASN A:524 , THR A:526BINDING SITE FOR RESIDUE NAG A 1016
17BC8SOFTWAREGLU A:560 , ALA A:584 , ASN A:585 , NAG A:1018 , ASP B:512BINDING SITE FOR RESIDUE NAG A 1017
18BC9SOFTWARENAG A:1017BINDING SITE FOR RESIDUE NAG A 1018
19CC1SOFTWAREASN A:943 , SER A:944 , NAG A:1020BINDING SITE FOR RESIDUE NAG A 1019
20CC2SOFTWARENAG A:1019 , BMA A:1021BINDING SITE FOR RESIDUE NAG A 1020
21CC3SOFTWARENAG A:1020 , MAN A:1022BINDING SITE FOR RESIDUE BMA A 1021
22CC4SOFTWAREBMA A:1021 , MAN A:1023BINDING SITE FOR RESIDUE MAN A 1022
23CC5SOFTWAREMAN A:1022 , MAN A:1024BINDING SITE FOR RESIDUE MAN A 1023
24CC6SOFTWAREBMA A:1005 , MAN A:1023BINDING SITE FOR RESIDUE MAN A 1024
25CC7SOFTWAREASP A:230 , ASN A:232 , ASP A:234 , ILE A:236 , ASP A:238BINDING SITE FOR RESIDUE MN A 1025
26CC8SOFTWAREASP A:284 , ASN A:286 , ASP A:288 , TYR A:290 , ASP A:292BINDING SITE FOR RESIDUE MN A 1026
27CC9SOFTWAREASP A:349 , ASP A:351 , ASP A:353 , PHE A:355 , ASP A:357BINDING SITE FOR RESIDUE MN A 1027
28DC1SOFTWAREASP A:413 , ASP A:415 , ASN A:417 , TYR A:419 , ASP A:421BINDING SITE FOR RESIDUE MN A 1028
29DC2SOFTWAREILE A:202 , LYS A:203 , TYR H:107BINDING SITE FOR RESIDUE NO3 A 1029
30DC3SOFTWAREPRO A:141 , ILE A:202 , GLN A:207 , THR H:28 , SER H:31 , PHE H:32BINDING SITE FOR RESIDUE NO3 A 1030
31DC4SOFTWAREASN B:99 , PHE B:100 , NAG B:705BINDING SITE FOR RESIDUE NAG B 701
32DC5SOFTWAREARG A:248 , ASN B:316 , ASN B:320 , NAG B:703BINDING SITE FOR RESIDUE NAG B 702
33DC6SOFTWARENAG B:702BINDING SITE FOR RESIDUE NAG B 703
34DC7SOFTWAREASN B:371 , SER B:398 , ILE B:399 , GLU B:400 , NAG B:705BINDING SITE FOR RESIDUE NAG B 704
35DC8SOFTWAREGLU B:400 , NAG B:701 , NAG B:704BINDING SITE FOR RESIDUE NAG B 705
36DC9SOFTWAREARG B:530 , TYR B:531 , ASN B:559BINDING SITE FOR RESIDUE NAG B 706
37EC1SOFTWARESER B:123 , ASP B:126 , ASP B:127 , MET B:335BINDING SITE FOR RESIDUE MN B 707

(-) SS Bonds  (36, 36)

Asymmetric/Biological Unit
No.Residues
1A:59 -A:67
2A:108 -A:128
3A:142 -A:155
4A:478 -A:535
5A:596 -A:602
6A:668 -A:681
7B:5 -B:23
8B:13 -B:435
9B:16 -B:38
10B:26 -B:49
11B:177 -B:184
12B:232 -B:273
13B:374 -B:386
14B:406 -B:433
15B:437 -B:457
16B:448 -B:460
17B:462 -B:471
18B:486 -B:501
19B:495 -B:506
20B:508 -B:521
21B:523 -B:544
22B:528 -B:542
23B:536 -B:547
24B:549 -B:558
25B:560 -B:583
26B:567 -B:581
27B:575 -B:586
28B:588 -B:598
29B:601 -B:604
30B:608 -B:655
31B:614 -B:635
32B:617 -B:631
33H:22 -H:96
34H:145 -H:200
35L:23 -L:88
36L:134 -L:194

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4O02)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4O02)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4O02)

(-) Exons   (0, 0)

(no "Exon" information available for 4O02)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:915
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeee..........eeee........eeeeee..............eeeeee......eee.........eee..ee.ee.........eeee..eeeeee...eee......ee...eeeee....eeee....................eeee.....eeeee.hhhhhh.eeeeehhhhhhhhh............ee....hhhhh.......eeee........eeeeee.hhhhhh.eeeee......eeeeee...........eeee........eeeeee...ee.......ee..eeeeee.......eeeeee...........eeeee........eeeeee...hhhhh.eeeee............eeee..............eee............eeeeehhh.eeeee....eeeeeeeeee......................eeeeeeeeeee........eeeeeeee............eee......eeeeeeee......eeeeeeeee..............eeeeeee.............ee......eeee.................eeeeee...........eeeeeeeeeee........eeeee.....eeeee.....................eeeee.........eeeeeeeeee...........eeeeee...........eee........eeeeeeee...ee..............hhhhhh.eeeeeeeeeee......eeeeeee..........eeeeee.....eeee....................eeeee......eeeeeeeeeee..............eeeeeeeeeeee............eeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4o02 A   1 FNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRILGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTW 953
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830  ||   878       888       898       908       918       928       938       948     
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          833|                                                                                 
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           872                                                                                 

Chain B from PDB  Type:PROTEIN  Length:687
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhhhhhh.....................hhhhhh............eeeeee.....................eeeeee....eeeeeeeee......eeeeeeee.hhhhhhhhhhhhhhhhhhhhhhh.....eeeeeeee.............hhhhh...............eeeeeeee..hhhhhhhhh............hhhhhhhhhhhh..........eeeeeeee.......hhhhh............................hhhhhhhhhhhh..eeeeee...hhhhhhhhhhhh...eeee......hhhhhhhhhhhhhh.eeeeeee.....eeeeeeeeee..eeee...eee......eeeeeeeeee........eeeeeee......eeeeeee....................................................................eee..eee................................eeee..eeee...ee.....ee............hhhh.eee....eee..................hhhhhhhhhhhhhhh...............................eeee.........eeee.........eee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4o02 B   1 GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPEC 687
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       

Chain H from PDB  Type:PROTEIN  Length:218
                                                                                                                                                                                                                                                          
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee...ee.....eeeeeeeee..hhhhh.eeeeee.....eeeeeee......eee.......eeeeee....eeeeeee..hhhhheeeeeeee.....eeee...eeee...........eee..........eeeeeeeeeee.....eeee.hhh....eee.........eee.eeeeee.........eeeee......eeeee.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4o02 H   1 QVQLQQSGAELAEPGASVKMSCKASGYTFSSFWMHWVKQRPGQGLEWIGYINPRSGYTECNEIFRDKATMTADTSSSTAYMQLSGLTSEDSAVYYCASFLGRGAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSAGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR 218
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210        

Chain L from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee....eeee.....eeeeeee.......eeeeeee..eeeeeee.............eeeee...eeeeee...hhhhh.eeeeee......ee...eeeee.......eee................eeeeeee.....eeeeee..ee....eeeeee........eeeeeee..hhhhhhhh.eeeeeee.......eeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4o02 L   1 DIQMTQTTSSLSASLGDRVIISCRASQDISNYLSWYQQKPDGTVKLLIFYTSKLHSGVPSRFSGSGSGTDYSLTISNLDQEDIATYFCQQGNTFPYTFGGGTKVEMRRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 214
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4O02)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4O02)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4O02)

(-) Gene Ontology  (104, 148)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NO3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
    DC2  [ RasMol ]  +environment [ RasMol ]
    DC3  [ RasMol ]  +environment [ RasMol ]
    DC4  [ RasMol ]  +environment [ RasMol ]
    DC5  [ RasMol ]  +environment [ RasMol ]
    DC6  [ RasMol ]  +environment [ RasMol ]
    DC7  [ RasMol ]  +environment [ RasMol ]
    DC8  [ RasMol ]  +environment [ RasMol ]
    DC9  [ RasMol ]  +environment [ RasMol ]
    EC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4o02)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4o02
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ITAV_HUMAN | P06756
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  ITB3_HUMAN | P05106
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ITAV_HUMAN | P06756
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  ITB3_HUMAN | P05106
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ITAV_HUMAN | P067561jv2 1l5g 1m1x 1u8c 3ije 4g1e 4g1m 4mmx 4mmy 4mmz 4um8 4um9 5ffg 5ffo 5nem 5ner 5net 5neu
        ITB3_HUMAN | P051061jv2 1kup 1kuz 1l5g 1m1x 1m8o 1miz 1mk7 1mk9 1rn0 1s4x 1tye 1u8c 2h7d 2h7e 2ini 2k9j 2knc 2kv9 2l1c 2l91 2ljd 2lje 2ljf 2mtp 2n9y 2q6w 2rmz 2rn0 2vc2 2vdk 2vdl 2vdm 2vdn 2vdo 2vdp 2vdq 2vdr 3fcs 3fcu 3ije 3nid 3nif 3nig 3t3m 3t3p 3zdx 3zdy 3zdz 3ze0 3ze1 3ze2 4cak 4g1e 4g1m 4hxj 4mmx 4mmy 4mmz 4z7n 4z7o 4z7q 5hdb

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4O02)