Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  INTERLEUKIN 21 RECEPTOR
 
Authors :  O. T. Hamming, L. Kang, P. Siupka, H. H. Gad, R. Hartmann
Date :  12 Dec 13  (Deposition) - 17 Dec 14  (Release) - 17 Dec 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.75
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  A (2x),B (2x),C (2x)
Keywords :  Fibronectine Iii Domain, Interleukin 21, Glycosylated, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  O. T. Hamming, L. Kang, P. Siupka, H. H. Gad, R. Hartmann
Interleukin 21 Receptor Structure And Function
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - INTERLEUKIN-21 RECEPTOR
    ChainsA, B, C
    EngineeredYES
    Expression SystemHOMO SAPIENS
    Expression System Cell LineHEK293 CELLS
    Expression System Taxid9606
    GeneIL21R, NILR, UNQ3121/PRO10273
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymIL-21 RECEPTOR, IL-21R, NOVEL INTERLEUKIN RECEPTOR

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABC
Biological Unit 1 (1x)A  
Biological Unit 2 (1x) B 
Biological Unit 3 (1x)  C
Biological Unit 4 (2x)A (2x)B (2x)C (2x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (8, 38)

Asymmetric Unit (8, 38)
No.NameCountTypeFull Name
1BMA3Ligand/IonBETA-D-MANNOSE
2CL11Ligand/IonCHLORIDE ION
3EDO1Ligand/Ion1,2-ETHANEDIOL
4FUC3Ligand/IonALPHA-L-FUCOSE
5MAN6Ligand/IonALPHA-D-MANNOSE
6NA5Ligand/IonSODIUM ION
7NAG6Ligand/IonN-ACETYL-D-GLUCOSAMINE
8TLA3Ligand/IonL(+)-TARTARIC ACID
Biological Unit 1 (5, 8)
No.NameCountTypeFull Name
1BMA1Ligand/IonBETA-D-MANNOSE
2CL-1Ligand/IonCHLORIDE ION
3EDO-1Ligand/Ion1,2-ETHANEDIOL
4FUC1Ligand/IonALPHA-L-FUCOSE
5MAN2Ligand/IonALPHA-D-MANNOSE
6NA-1Ligand/IonSODIUM ION
7NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
8TLA2Ligand/IonL(+)-TARTARIC ACID
Biological Unit 2 (5, 7)
No.NameCountTypeFull Name
1BMA1Ligand/IonBETA-D-MANNOSE
2CL-1Ligand/IonCHLORIDE ION
3EDO-1Ligand/Ion1,2-ETHANEDIOL
4FUC1Ligand/IonALPHA-L-FUCOSE
5MAN2Ligand/IonALPHA-D-MANNOSE
6NA-1Ligand/IonSODIUM ION
7NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
8TLA1Ligand/IonL(+)-TARTARIC ACID
Biological Unit 3 (5, 7)
No.NameCountTypeFull Name
1BMA1Ligand/IonBETA-D-MANNOSE
2CL-1Ligand/IonCHLORIDE ION
3EDO1Ligand/Ion1,2-ETHANEDIOL
4FUC1Ligand/IonALPHA-L-FUCOSE
5MAN2Ligand/IonALPHA-D-MANNOSE
6NA-1Ligand/IonSODIUM ION
7NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
8TLA-1Ligand/IonL(+)-TARTARIC ACID
Biological Unit 4 (0, 0)
No.NameCountTypeFull Name
1BMA-1Ligand/IonBETA-D-MANNOSE
2CL-1Ligand/IonCHLORIDE ION
3EDO-1Ligand/Ion1,2-ETHANEDIOL
4FUC-1Ligand/IonALPHA-L-FUCOSE
5MAN-1Ligand/IonALPHA-D-MANNOSE
6NA-1Ligand/IonSODIUM ION
7NAG-1Ligand/IonN-ACETYL-D-GLUCOSAMINE
8TLA-1Ligand/IonL(+)-TARTARIC ACID

(-) Sites  (20, 20)

Asymmetric Unit (20, 20)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREARG A:182 , THR A:194 , TRP A:195 , MAN A:306BINDING SITE FOR RESIDUE MAN A 301
02AC2SOFTWARETYR A:137 , ASP A:160BINDING SITE FOR RESIDUE NA A 307
03AC3SOFTWAREASP A:160BINDING SITE FOR RESIDUE CL A 311
04AC4SOFTWARESER A:87 , GLY B:133 , LYS B:134BINDING SITE FOR RESIDUE CL A 313
05AC5SOFTWARELYS A:100 , PRO A:101 , GLU A:197 , HOH A:403 , HOH A:424 , THR C:8 , ASP C:9 , THR C:13 , ILE C:15BINDING SITE FOR RESIDUE TLA A 314
06AC6SOFTWAREASP A:9 , THR A:13 , ILE A:15 , HOH A:426 , LYS C:100 , HOH C:408 , HOH C:434BINDING SITE FOR RESIDUE TLA A 315
07AC7SOFTWAREARG B:182 , THR B:194 , TRP B:195 , BMA B:305BINDING SITE FOR RESIDUE MAN B 301
08AC8SOFTWAREPRO B:185BINDING SITE FOR RESIDUE CL B 307
09AC9SOFTWAREHIS B:24BINDING SITE FOR RESIDUE CL B 308
10BC1SOFTWAREBMA B:305BINDING SITE FOR RESIDUE CL B 309
11BC2SOFTWARELYS B:100BINDING SITE FOR RESIDUE CL B 310
12BC3SOFTWARETYR B:137 , ASP B:160BINDING SITE FOR RESIDUE CL B 311
13BC4SOFTWAREASP B:9 , LYS B:100 , PRO B:101 , PRO B:103BINDING SITE FOR RESIDUE TLA B 312
14BC5SOFTWAREARG C:182 , THR C:194 , TRP C:195 , HOH C:445BINDING SITE FOR RESIDUE MAN C 301
15BC6SOFTWAREHIS B:49BINDING SITE FOR RESIDUE NA C 307
16BC7SOFTWAREHOH C:426BINDING SITE FOR RESIDUE CL C 309
17BC8SOFTWAREASP A:3 , NAG C:304BINDING SITE FOR RESIDUE EDO C 311
18BC9SOFTWAREALA A:52 , HIS A:53 , ASN A:54 , THR A:59 , MAN A:301 , HOH A:408 , HOH A:412 , HOH A:428 , HOH A:433 , HOH A:435 , ILE C:17BINDING SITE FOR CHAIN A OF SUGAR BOUND TO ASN A 54 RESIDUES 302 TO 306
19CC1SOFTWAREASN B:54 , HIS B:57 , THR B:59 , ARG B:154 , MAN B:301 , CL B:309 , HOH B:417BINDING SITE FOR CHAIN B OF SUGAR BOUND TO ASN B 54 RESIDUES 302 TO 306
20CC2SOFTWAREASN C:54 , HIS C:57 , THR C:59 , EDO C:311 , HOH C:415 , HOH C:421 , HOH C:445 , HOH C:456 , HOH C:460BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 54 RESIDUES 302 TO 306

(-) SS Bonds  (9, 9)

Asymmetric Unit
No.Residues
1A:1 -C:90
2A:6 -A:16
3A:46 -A:62
4A:90 -C:1
5B:1 -B:90
6B:6 -B:16
7B:46 -B:62
8C:6 -C:16
9C:46 -C:62

(-) Cis Peptide Bonds  (6, 6)

Asymmetric Unit
No.Residues
1His A:24 -Pro A:25
2Ala A:43 -Thr A:44
3Leu A:211 -Lys A:212
4His B:24 -Pro B:25
5His C:24 -Pro C:25
6Glu C:213 -His C:214

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4NZD)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4NZD)

(-) Exons   (0, 0)

(no "Exon" information available for 4NZD)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee.....eeeee......................eeeee....eeee............eeeeeee......eeeeeeee.hhh......eeeeeee...eeeeee..............eeeeeeeee.........eeeee.....eeeehhhhh....eeeeeeeeee................eeee............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4nzd A   1 CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVQITDQSGQYSQECGSFLLAESIKPAPPFDVTVTFSGQYQISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEHHHHH 218
                                    10        20        30  ||    48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218
                                                           33|                                                                                                                                                                                
                                                            42                                                                                                                                                                                

Chain B from PDB  Type:PROTEIN  Length:208
                                                                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee....eeeeee........eeeeeee...............eeeee....eeeeee..........eeeeeee......eeeeeeee.hhh......eeeeeee...eeeeee..............eeeeeeeee.........eeeee.....eeeehhhhh....eeeeeeeeee................eeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4nzd B   1 CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVQITDQSGQYSQECGSFLLAESIKPAPPFDVTVTFSGQYQISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQS 208
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200        

Chain C from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee.....eeeee......................eeeee....eeee............eeeeeee......eeeeeeee.hhh......eeeeeee...eeeeee..............eeeeeeeee.........eeeee.....eeeehhhhh....eeeeeeeeee................eeee............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4nzd C   1 CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVQITDQSGQYSQECGSFLLAESIKPAPPFDVTVTFSGQYQISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEHHHHH 218
                                    10        20        30   ||   48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218
                                                            34|                                                                                                                                                                               
                                                             43                                                                                                                                                                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4NZD)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4NZD)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4NZD)

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FUC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TLA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:43 - Thr A:44   [ RasMol ]  
    Glu C:213 - His C:214   [ RasMol ]  
    His A:24 - Pro A:25   [ RasMol ]  
    His B:24 - Pro B:25   [ RasMol ]  
    His C:24 - Pro C:25   [ RasMol ]  
    Leu A:211 - Lys A:212   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4nzd
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IL21R_HUMAN | Q9HBE5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  IL21R_HUMAN | Q9HBE5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IL21R_HUMAN | Q9HBE53tgx

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4NZD)