Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP22 (AKA FKBP14) CONTAINING TWO EF-HAND MOTIFS
 
Authors :  S. P. Boudko, Y. Ishikawa, H. P. Bachinger
Date :  18 Sep 13  (Deposition) - 25 Dec 13  (Release) - 05 Feb 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Fkbp-Type Domain, Ef-Hand Motif, Peptidyl-Prolyl Cis-Trans Isomerase, Calcium Binding, Endoplasmic Reticulum, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. P. Boudko, Y. Ishikawa, J. Nix, M. S. Chapman, H. P. Bachinger
Structure Of Human Peptidyl-Prolyl Cis-Trans Isomerase Fkbp22 Containing Two Ef-Hand Motifs.
Protein Sci. V. 23 67 2014
PubMed-ID: 24272907  |  Reference-DOI: 10.1002/PRO.2391

(-) Compounds

Molecule 1 - PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP14
    ChainsA, B
    EC Number5.2.1.8
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET30A(+)
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneFKBP14, FKBP22, UNQ322/PRO381
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPPIASE FKBP14, 22 KDA FK506-BINDING PROTEIN, 22 KDA FKBP, FKBP-22, FK506-BINDING PROTEIN 14, FKBP-14, ROTAMASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 15)

Asymmetric/Biological Unit (3, 15)
No.NameCountTypeFull Name
11PE2Ligand/IonPENTAETHYLENE GLYCOL
2CA5Ligand/IonCALCIUM ION
3PGO8Ligand/IonS-1,2-PROPANEDIOL

(-) Sites  (15, 15)

Asymmetric Unit (15, 15)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:129 , ASN A:131 , ASP A:133 , LYS A:135 , GLU A:140 , HOH A:345BINDING SITE FOR RESIDUE CA A 201
02AC2SOFTWAREASP A:173 , ASP A:175 , ASP A:177 , PHE A:179 , GLU A:184 , HOH A:358BINDING SITE FOR RESIDUE CA A 202
03AC3SOFTWAREGLU A:172 , GLU A:184 , TYR A:187 , HIS A:189BINDING SITE FOR RESIDUE CA A 203
04AC4SOFTWARELEU A:145 , HIS A:152 , PGO A:206 , LEU B:145 , GLU B:148 , HIS B:152BINDING SITE FOR RESIDUE 1PE A 204
05AC5SOFTWAREALA A:89 , GLY A:93 , LYS A:94 , GLU A:95 , GLU A:103BINDING SITE FOR RESIDUE 1PE A 205
06AC6SOFTWAREHIS A:152 , GLY A:153 , ALA A:154 , 1PE A:204 , LYS B:188BINDING SITE FOR RESIDUE PGO A 206
07AC7SOFTWAREPRO A:16 , PHE A:17 , CYS A:19 , ASP B:132BINDING SITE FOR RESIDUE PGO A 207
08AC8SOFTWAREHIS A:32 , TYR A:33 , HIS A:48 , LYS A:81 , ASN A:109 , HOH A:383BINDING SITE FOR RESIDUE PGO A 208
09AC9SOFTWAREASP B:129 , ASN B:131 , ASP B:133 , LYS B:135 , GLU B:140 , HOH B:308BINDING SITE FOR RESIDUE CA B 201
10BC1SOFTWAREASP B:173 , ASP B:175 , ASP B:177 , PHE B:179 , GLU B:184 , HOH B:428BINDING SITE FOR RESIDUE CA B 202
11BC2SOFTWAREARG A:120 , SER A:124 , PHE A:185 , HIS B:152BINDING SITE FOR RESIDUE PGO B 203
12BC3SOFTWARETRP A:57 , ARG A:116 , ILE B:115 , HOH B:316 , HOH B:392BINDING SITE FOR RESIDUE PGO B 204
13BC4SOFTWAREHIS B:20 , HOH B:338BINDING SITE FOR RESIDUE PGO B 205
14BC5SOFTWAREVAL B:12 , HOH B:423BINDING SITE FOR RESIDUE PGO B 206
15BC6SOFTWAREILE A:56 , TRP A:57 , HOH A:313 , HOH A:320 , LEU B:28 , TRP B:57 , ARG B:116BINDING SITE FOR RESIDUE PGO B 207

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:19 -A:77
2B:19 -B:77

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4MSP)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4MSP)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4MSP)

(-) Exons   (0, 0)

(no "Exon" information available for 4MSP)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:189
                                                                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeee.............eeeeeeeeee.....eeee...hhhhh.eeee......hhhhhhhh.......eeeeeehhhhh..............eeeeeeeeeee....hhhhhhhhh.....eeehhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh.....eeehhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4msp A   2 LIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHD 190
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181         

Chain B from PDB  Type:PROTEIN  Length:189
                                                                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeee.............eeeeeeeeee.....eeeehhhhh....eeee......hhhhhhhh.......eeeeeehhhhh..............eeeeeeeeeee....hhhhhhhhh.....eehhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh......eehhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4msp B   3 IPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDE 191
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4MSP)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4MSP)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4MSP)

(-) Gene Ontology  (12, 12)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1PE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PGO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4msp)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4msp
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FKB14_HUMAN | Q9NWM8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.2.1.8
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FKB14_HUMAN | Q9NWM8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FKB14_HUMAN | Q9NWM84dip

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4MSP)