Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE BRAF:MEK1 COMPLEX
 
Authors :  J. Sudhamsu, J. R. Haling, T. Morales, B. Brandhuber, S. G. Hymowitz
Date :  10 Sep 13  (Deposition) - 18 Jun 14  (Release) - 24 Sep 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.85
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A,B,C,D  (1x)
Biol. Unit 2:  E,F,G,H  (1x)
Keywords :  Raf, Mapk, Kinase Domain, Atp-Binding, Erk, Ras, Pak, Transferase- Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. R. Haling, J. Sudhamsu, I. Yen, S. Sideris, W. Sandoval, W. Phung, B. J. Bravo, A. M. Giannetti, A. Peck, A. Masselot, T. Morales, D. Smith B. J. Brandhuber, S. G. Hymowitz, S. Malek
Structure Of The Braf-Mek Complex Reveals A Kinase Activity Independent Role For Braf In Mapk Signaling.
Cancer Cell V. 26 402 2014
PubMed-ID: 25155755  |  Reference-DOI: 10.1016/J.CCR.2014.07.007

(-) Compounds

Molecule 1 - DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE KINASE 1
    ChainsA, D, E, H
    EC Number2.7.12.2
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainROSETTA 2 DE3
    Expression System Taxid469008
    FragmentUNP RESIDUES 62-393
    GeneMAP2K1, MEK1, PRKMK1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMAP KINASE KINASE 1, MAPKK 1, MKK1, ERK ACTIVATOR KINASE 1, MAPK/ERK KINASE 1, MEK 1
 
Molecule 2 - SERINE/THREONINE-PROTEIN KINASE B-RAF
    ChainsB, C, F, G
    EC Number2.7.11.1
    EngineeredYES
    Expression SystemTRICHOPLUSIA NI
    Expression System CommonCABBAGE LOOPER
    Expression System Taxid7111
    Expression System Vector TypeBACULOVIRUS
    FragmentKINASE DOMAIN (UNP RESIDUES 432-726)
    GeneBRAF, BRAF1, RAFB1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymBRAF, PROTO-ONCOGENE B-RAF, P94, V-RAF MURINE SARCOMA VIRAL ONCOGENE HOMOLOG B1

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit ABCDEFGH
Biological Unit 1 (1x)ABCD    
Biological Unit 2 (1x)    EFGH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 14)

Asymmetric Unit (4, 14)
No.NameCountTypeFull Name
15735Ligand/Ion7-FLUORO-3-[(2-FLUORO-4-IODOPHENYL)AMINO]-N-{[(2S)-2-HYDROXYPROPYL]OXY}FURO[3,2-C]PYRIDINE-2-CARBOXAMIDE
2ACP4Ligand/IonPHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER
3CL1Ligand/IonCHLORIDE ION
4MG4Ligand/IonMAGNESIUM ION
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
15732Ligand/Ion7-FLUORO-3-[(2-FLUORO-4-IODOPHENYL)AMINO]-N-{[(2S)-2-HYDROXYPROPYL]OXY}FURO[3,2-C]PYRIDINE-2-CARBOXAMIDE
2ACP2Ligand/IonPHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER
3CL-1Ligand/IonCHLORIDE ION
4MG-1Ligand/IonMAGNESIUM ION
Biological Unit 2 (2, 5)
No.NameCountTypeFull Name
15733Ligand/Ion7-FLUORO-3-[(2-FLUORO-4-IODOPHENYL)AMINO]-N-{[(2S)-2-HYDROXYPROPYL]OXY}FURO[3,2-C]PYRIDINE-2-CARBOXAMIDE
2ACP2Ligand/IonPHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER
3CL-1Ligand/IonCHLORIDE ION
4MG-1Ligand/IonMAGNESIUM ION

(-) Sites  (14, 14)

Asymmetric Unit (14, 14)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLY A:75 , ALA A:76 , GLY A:77 , ASN A:78 , GLY A:80 , VAL A:82 , ALA A:95 , LYS A:97 , MET A:143 , GLU A:144 , MET A:146 , SER A:150 , GLN A:153 , LYS A:192 , SER A:194 , ASN A:195 , LEU A:197 , ASP A:208 , MG A:902 , 573 A:903 , HOH A:1001 , HOH A:1002 , HOH A:1004BINDING SITE FOR RESIDUE ACP A 901
02AC2SOFTWAREASN A:195 , ASP A:208 , ACP A:901 , HOH A:1001 , HOH A:1002BINDING SITE FOR RESIDUE MG A 902
03AC3SOFTWAREASN A:78 , GLY A:79 , GLY A:80 , LYS A:97 , ILE A:99 , LEU A:115 , VAL A:127 , ILE A:141 , MET A:143 , CYS A:207 , ASP A:208 , PHE A:209 , GLY A:210 , VAL A:211 , SER A:212 , LEU A:215 , ILE A:216 , ACP A:901BINDING SITE FOR RESIDUE 573 A 903
04AC4SOFTWARELEU D:74 , GLY D:75 , GLY D:77 , ASN D:78 , GLY D:80 , VAL D:82 , ALA D:95 , LYS D:97 , MET D:143 , GLU D:144 , MET D:146 , SER D:150 , GLN D:153 , LYS D:192 , SER D:194 , ASN D:195 , LEU D:197 , ASP D:208 , MG D:902 , 573 D:903 , HOH D:1001 , HOH D:1002 , HOH D:1009BINDING SITE FOR RESIDUE ACP D 901
05AC5SOFTWAREASN D:195 , ASP D:208 , ACP D:901 , HOH D:1001 , HOH D:1002BINDING SITE FOR RESIDUE MG D 902
06AC6SOFTWAREGLY D:77 , GLY D:80 , LYS D:97 , VAL D:127 , ILE D:141 , ASP D:208 , PHE D:209 , GLY D:210 , VAL D:211 , SER D:212 , LEU D:215 , ILE D:216 , MET D:219 , ACP D:901BINDING SITE FOR RESIDUE 573 D 903
07AC7SOFTWARELEU E:74 , GLY E:77 , ASN E:78 , VAL E:82 , ALA E:95 , LYS E:97 , MET E:143 , GLU E:144 , MET E:146 , SER E:150 , GLN E:153 , LYS E:192 , SER E:194 , ASN E:195 , ASP E:208 , MG E:902 , 573 E:903 , HOH E:1001 , HOH E:1002BINDING SITE FOR RESIDUE ACP E 901
08AC8SOFTWAREASN E:195 , ASP E:208 , ACP E:901 , HOH E:1001 , HOH E:1002BINDING SITE FOR RESIDUE MG E 902
09AC9SOFTWAREASN E:78 , GLY E:79 , LYS E:97 , VAL E:127 , ILE E:141 , MET E:143 , CYS E:207 , ASP E:208 , PHE E:209 , GLY E:210 , VAL E:211 , SER E:212 , LEU E:215 , ILE E:216 , MET E:219 , ACP E:901BINDING SITE FOR RESIDUE 573 E 903
10BC1SOFTWARELYS F:591 , LYS G:591BINDING SITE FOR RESIDUE CL F 801
11BC2SOFTWARELEU H:74 , ALA H:76 , GLY H:77 , ASN H:78 , GLY H:80 , ALA H:95 , LYS H:97 , MET H:143 , GLU H:144 , MET H:146 , SER H:150 , GLN H:153 , LYS H:192 , SER H:194 , ASN H:195 , LEU H:197 , ASP H:208 , MG H:902 , 573 H:903 , HOH H:1001 , HOH H:1002 , HOH H:1006BINDING SITE FOR RESIDUE ACP H 901
12BC3SOFTWAREASN H:195 , ASP H:208 , ACP H:901 , HOH H:1001 , HOH H:1002BINDING SITE FOR RESIDUE MG H 902
13BC4SOFTWAREARG G:662 , ASN H:78 , GLY H:79 , GLY H:80 , LYS H:97 , LEU H:118 , VAL H:127 , ILE H:141 , MET H:143 , CYS H:207 , ASP H:208 , PHE H:209 , GLY H:210 , VAL H:211 , SER H:212 , LEU H:215 , ILE H:216 , MET H:219 , ACP H:901 , HOH H:1001 , HOH H:1006BINDING SITE FOR RESIDUE 573 H 903
14BC5SOFTWAREARG B:691 , LEU B:692 , GLU B:695 , GLN B:709 , SER B:713 , LEU B:716 , HIS H:87 , LEU H:92 , MET H:94 , HIS H:119 , TYR H:130BINDING SITE FOR RESIDUE 573 H 904

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4MNE)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric Unit
No.Residues
1Ile A:263 -Pro A:264
2Ile D:263 -Pro D:264
3Ile E:263 -Pro E:264
4Lys F:522 -Pro F:523
5Lys G:522 -Pro G:523
6Ile H:263 -Pro H:264

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4MNE)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4MNE)

(-) Exons   (0, 0)

(no "Exon" information available for 4MNE)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:286
                                                                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhh.eeeeeeeee...eeeeeeee.....eeeeeeee...hhhhhhhhhhhhhhhhhh.......eeeeeee..eeeeeee....eehhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh......hhh.eee.....eee.....hhhhhhhh...........hhhhhh....hhhhhhhhhhhhhhhhhhh.......hhhhhhhh...hhhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhh..hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4mne A  63 LKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTI 379
                                    72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272 ||    313       323       333       343       353       363       373      
                                                                                                                                                                                                                                             274|                                                                         
                                                                                                                                                                                                                                              306                                                                         

Chain B from PDB  Type:PROTEIN  Length:270
                                                                                                                                                                                                                                                                                                              
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .............eee.eeeeee...eeeeee......hhhhhhhhhhhhhhhh.........eeeee.....eeeee.....hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eeeehhheeee......ee...............hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhh.....hhhhh....hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4mne B 449 DWEIPDGQITVGQRIGGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP 722
                                   458     ||472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672       682       692       702       712       722
                                         464|                                                                                                                                                                                                                                                             
                                          469                                                                                                                                                                                                                                                             

Chain C from PDB  Type:PROTEIN  Length:260
                                                                                                                                                                                                                                                                                                    
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeee...eeeee...eeeeeee.....hhhhhhhhhhhhhhhh.........eeeee....eeeeee...eeehhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eeee...eeee......ee........hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhh.....hhhhh....hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4mne C 449 DWEIPDGQITVGQRIGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS 720
                                   458    || 473       483       493       503       513       523       533       543       553       563       573       583       593       610       620       630       640       650       660       670       680       690       700       710       720
                                        463|                                                                                                                                  602|                                                                                                              
                                         469                                                                                                                                   610                                                                                                              

Chain D from PDB  Type:PROTEIN  Length:285
                                                                                                                                                                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeee..eeeeeeee....eeeeeeeee...hhhhhhhhhhhhhhhhhh.......eeeeee...eeeeee......hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh......hhh.eee.....eee.....hhhhhhhh...........hhhhhh....hhhhhhhhhhhhhhhhhhh.......hhhhhhh...hhhhhhhhhhhh..........hhhhhhhhhhhh........hhhhhhhhhhhhhhhhh..hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4mne D  66 DDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN 382
                                    75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       307       317       327       337       347       357       367       377     
                                                                                                                                                                                                                                          274|                                                                           
                                                                                                                                                                                                                                           307                                                                           

Chain E from PDB  Type:PROTEIN  Length:286
                                                                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhh.eeeeeeeee...eeeeeeee.....eeeeeeee...hhhhhhhhhhhhhhhh.........eeeeee...eeeeee.....eehhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh......hhh.eee.....eee.....hhhhhhhh...........hhhhhh.....hhhhhhhhhhhhhhhhhh.......hhhhhhh...hhhhhhhhhhhh..........hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh..hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4mne E  62 ELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTI 379
                                    71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271  ||   313       323       333       343       353       363       373      
                                                                                                                                                                                                                                              274|                                                                        
                                                                                                                                                                                                                                               307                                                                        

Chain F from PDB  Type:PROTEIN  Length:258
                                                                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .........eeeee..eeeee...eeeeee......hhhhhhhhhhhhhhhh.........eeeee.....eeeee.....hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eeeehhheeee......ee......hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhh.....hhhhh....hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4mne F 449 DWEIPDGQITVGQRITVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSL 721
                                   458    || 474       484       494       504       514       524       534       544       554       564       574       584       594       613       623       633       643       653       663       673       683       693       703       713        
                                        463|                                                                                                                                 602|                                                                                                             
                                         470                                                                                                                                  612                                                                                                             

Chain G from PDB  Type:PROTEIN  Length:259
                                                                                                                                                                                                                                                                                                   
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeee...eeeee...eeeeee......hhhhhhhhhhhhhhhhh........eeeee.....eeeee.....hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eeeehhheeee......ee.......hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhh.....hhhhh....hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4mne G 449 DWEIPDGQITVGQRIGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS 720
                                   458    || 473       483       493       503       513       523       533       543       553       563       573       583       593       611       621       631       641       651       661       671       681       691       701       711         
                                        463|                                                                                                                                  602|                                                                                                             
                                         469                                                                                                                                   611                                                                                                             

Chain H from PDB  Type:PROTEIN  Length:275
                                                                                                                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee...eeeeeeee.....eeeeeeee...hhhhhhhhhhhhhhhhhh.......eeeeee...eeeeee.....eehhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh......hhh.eee.....eee.....hhhhhhhhh..........hhhhhh.....hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhh...hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4mne H  66 DDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIG 380
                                    75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265||     315       325       335       345       355       365       375     
                                                                                                                                                                                                                                  266|                                                                         
                                                                                                                                                                                                                                   307                                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4MNE)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4MNE)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4MNE)

(-) Gene Ontology  (111, 135)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    573  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ACP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ile A:263 - Pro A:264   [ RasMol ]  
    Ile D:263 - Pro D:264   [ RasMol ]  
    Ile E:263 - Pro E:264   [ RasMol ]  
    Ile H:263 - Pro H:264   [ RasMol ]  
    Lys F:522 - Pro F:523   [ RasMol ]  
    Lys G:522 - Pro G:523   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4mne
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BRAF_HUMAN | P15056
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  MP2K1_HUMAN | Q02750
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
  2.7.12.2
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  BRAF_HUMAN | P15056
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  MP2K1_HUMAN | Q02750
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BRAF_HUMAN | P150561uwh 1uwj 2fb8 2l05 3c4c 3d4q 3idp 3ii5 3ny5 3og7 3ppj 3ppk 3prf 3pri 3psb 3psd 3q4c 3q96 3skc 3tv4 3tv6 4cqe 4dbn 4e26 4e4x 4ehe 4ehg 4fc0 4fk3 4g9c 4g9r 4h58 4jvg 4ksp 4ksq 4mbj 4mnf 4pp7 4r5y 4rzv 4rzw 4wo5 4xv1 4xv2 4xv3 4xv9 4yht 5c9c 5csw 5csx 5ct7 5fd2 5hi2 5hid 5hie 5ita 5j17 5j18 5j2r 5jrq 5jsm 5jt2 5val 5vam
        MP2K1_HUMAN | Q027501s9j 2p55 3dv3 3dy7 3e8n 3eqb 3eqc 3eqd 3eqf 3eqg 3eqh 3eqi 3mbl 3orn 3os3 3pp1 3sls 3v01 3v04 3vvh 3w8q 3wig 3zls 3zlw 3zlx 3zly 3zm4 4an2 4an3 4an9 4anb 4ark 4lmn 4u7z 4u80 4u81 5bx0 5eym 5hze

(-) Related Entries Specified in the PDB File

2y4i CRYSTAL STRUCTURE OF THE KSR2:MEK1 COMPLEX
4mnf