Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE COILED COIL DOMAIN OF MURF1
 
Authors :  O. Mayans, B. Franke
Date :  06 Aug 13  (Deposition) - 26 Mar 14  (Release) - 26 Mar 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  E3 Ubiquitin Ligase, Titin, Sarcoskeleton, Ligase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. Franke, A. Gasch, R. Rodriguez, M. Chami, M. M. Khan, R. Rudolf, J. Bibby, A. Hanashima, J. Bogomolovas, E. Von Castelmur, D. J. Rigden, I. Uson, S. Labeit, O. Mayans
Molecular Basis For The Fold Organization And Sarcomeric Targeting Of The Muscle Atrogin Murf1
Open Biol. V. 4 30172 2014
PubMed: search

(-) Compounds

Molecule 1 - E3 UBIQUITIN-PROTEIN LIGASE TRIM63
    ChainsA, C, B, D
    EC Number6.3.2.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPETM-11
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 214-271
    GeneIRF, MURF1, RNF28, SMRZ, TRIM63
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymIRIS RING FINGER PROTEIN, MUSCLE-SPECIFIC RING FINGER PROTEIN 1, MURF-1, MURF1, RING FINGER PROTEIN 28, STRIATED MUSCLE RING ZINC FINGER PROTEIN, TRIPARTITE MOTIF-CONTAINING PROTEIN 63

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 21)

Asymmetric/Biological Unit (3, 21)
No.NameCountTypeFull Name
1ACT9Ligand/IonACETATE ION
2GOL11Ligand/IonGLYCEROL
3MPD1Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL

(-) Sites  (20, 20)

Asymmetric Unit (20, 20)
No.NameEvidenceResiduesDescription
01AC1SOFTWARELEU A:227 , ARG C:230 , ACT C:307 , HOH C:410BINDING SITE FOR RESIDUE MPD A 301
02AC2SOFTWAREGLN A:247 , TYR C:249 , LYS D:257 , THR D:261BINDING SITE FOR RESIDUE GOL A 302
03AC3SOFTWARETYR A:217 , ASP A:221 , LYS C:223BINDING SITE FOR RESIDUE GOL A 303
04AC4SOFTWARESER A:240 , ALA A:244 , GLN A:247BINDING SITE FOR RESIDUE ACT A 304
05AC5SOFTWAREGLU A:237 , TYR D:216BINDING SITE FOR RESIDUE ACT A 305
06AC6SOFTWAREGLU C:243BINDING SITE FOR RESIDUE GOL C 301
07AC7SOFTWARELEU C:227BINDING SITE FOR RESIDUE GOL C 302
08AC8SOFTWARELYS C:224BINDING SITE FOR RESIDUE ACT C 303
09AC9SOFTWAREGLU C:234 , GLU C:243BINDING SITE FOR RESIDUE GOL C 304
10BC1SOFTWAREGLU C:236 , GLU C:243BINDING SITE FOR RESIDUE GOL C 305
11BC2SOFTWAREMPD A:301 , ARG C:230 , GLU C:234 , HOH C:410BINDING SITE FOR RESIDUE ACT C 307
12BC3SOFTWARESER A:225 , GLU B:226 , HOH B:404BINDING SITE FOR RESIDUE GOL B 301
13BC4SOFTWAREILE A:219 , GLN B:233 , GLU B:236 , SER B:240 , LEU C:220BINDING SITE FOR RESIDUE GOL B 302
14BC5SOFTWARETHR B:262 , SER B:266 , HOH B:403 , LEU C:259BINDING SITE FOR RESIDUE GOL B 303
15BC6SOFTWAREILE A:219 , GLU A:222 , ARG B:230BINDING SITE FOR RESIDUE ACT B 304
16BC7SOFTWARELEU B:227BINDING SITE FOR RESIDUE ACT B 305
17BC8SOFTWAREGLN A:229 , THR A:232 , GLN C:235 , LYS C:238 , LEU C:239BINDING SITE FOR RESIDUE GOL B 306
18BC9SOFTWAREARG B:230 , GLU B:234BINDING SITE FOR RESIDUE ACT B 307
19CC1SOFTWAREALA D:243 , GLN D:247BINDING SITE FOR RESIDUE GOL D 301
20CC2SOFTWARELYS B:223 , LEU D:219 , LYS D:223BINDING SITE FOR RESIDUE ACT D 302

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4M3L)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4M3L)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4M3L)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4M3L)

(-) Exons   (0, 0)

(no "Exon" information available for 4M3L)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:60
                                                                                            
               SCOP domains ------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------ Transcript
                 4m3l A  -3 GAMDTLYAILDEKKSELLQRITQEQEEKLSFIEALIQQYQEQLDKSTKLVETAIQSLDEP 270
                              ||   220       230       240       250       260       270
                             -1|                                                        
                             214                                                        

Chain B from PDB  Type:PROTEIN  Length:58
                                                                                          
               SCOP domains ---------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------- Transcript
                 4m3l B  -3 GAMDTLYAILDEKKSELLQRITQEQEEKLSFIEALIQQYQEQLDKSTKLVETAIQSLD 268
                              ||   220       230       240       250       260        
                             -1|                                                      
                             214                                                      

Chain C from PDB  Type:PROTEIN  Length:57
                                                                                         
               SCOP domains --------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------- Transcript
                 4m3l C  -2 AMDTLYAILDEKKSELLQRITQEQEEKLSFIEALIQQYQEQLDKSTKLVETAIQSLD 268
                             ||    221       231       241       251       261       
                            -1|                                                      
                            214                                                      

Chain D from PDB  Type:PROTEIN  Length:53
                                                                                     
               SCOP domains ----------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------- Transcript
                 4m3l D 214 TLYAILDEKKSELLQRITQEQEEKLSFIEALIQQYQEQLDKSTKLVETAIQSL 266
                                   223       233       243       253       263   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4M3L)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4M3L)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4M3L)

(-) Gene Ontology  (21, 21)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MPD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4m3l)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4m3l
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TRI63_HUMAN | Q969Q1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  6.3.2.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TRI63_HUMAN | Q969Q1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TRI63_HUMAN | Q969Q12d8u 3ddt

(-) Related Entries Specified in the PDB File

3ddt