Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MOZ DOUBLE PHD FINGER
 
Authors :  I. Dreveny, S. E. Deeves, B. Yue, D. M. Heery
Date :  05 Jul 13  (Deposition) - 16 Oct 13  (Release) - 05 Feb 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym./Biol. Unit :  A
Keywords :  Plant Homeodomain Finger, Double Phd, Zinc Finger, Histone Acetyl Transferase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  I. Dreveny, S. E. Deeves, J. Fulton, B. Yue, M. Messmer, A. Bhattacharya, H. M. Collins, D. M. Heery
The Double Phd Finger Domain Of Moz/Myst3 Induces Alpha-Helical Structure Of The Histone H3 Tail To Facilitat Acetylation And Methylation Sampling And Modification.
Nucleic Acids Res. V. 42 822 2014
PubMed-ID: 24150941  |  Reference-DOI: 10.1093/NAR/GKT931

(-) Compounds

Molecule 1 - HISTONE ACETYLTRANSFERASE KAT6A
    ChainsA
    EC Number2.3.1.48
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET15B
    Expression System StrainROSETTA 2
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 194-323
    GeneKAT6A, MOZ, MYST3, RUNXBP2, ZNF220
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMOZ, YBF2/SAS3, SAS2 AND TIP60 PROTEIN 3, MYST-3, MONOCYTIC LEUKEMIA ZINC FINGER PROTEIN, RUNT-RELATED TRANSCRIPTION FACTOR- BINDING PROTEIN 2, ZINC FINGER PROTEIN 220

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric/Biological Unit (1, 4)
No.NameCountTypeFull Name
1ZN4Ligand/IonZINC ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS A:281 , CYS A:284 , CYS A:307 , CYS A:310BINDING SITE FOR RESIDUE ZN A 401
2AC2SOFTWARECYS A:265 , CYS A:268 , HIS A:289 , CYS A:292BINDING SITE FOR RESIDUE ZN A 402
3AC3SOFTWARECYS A:209 , CYS A:212 , HIS A:238 , CYS A:241BINDING SITE FOR RESIDUE ZN A 403
4AC4SOFTWARECYS A:230 , CYS A:233 , CYS A:259 , CYS A:262BINDING SITE FOR RESIDUE ZN A 404

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4LJN)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Asp A:294 -Pro A:295

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4LJN)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4LJN)

(-) Exons   (0, 0)

(no "Exon" information available for 4LJN)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:120
                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhh............................ee......ee.......hhhhhhhhhh...................eee......eee.hhh....................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript
                 4ljn A 193 ELPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRPRKKG 316
                                   202       212       222       232       242       252       262      |276       286       296       306       316
                                                                                                      269|                                          
                                                                                                       274                                          

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4LJN)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4LJN)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4LJN)

(-) Gene Ontology  (31, 31)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asp A:294 - Pro A:295   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4ljn
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KAT6A_HUMAN | Q92794
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.48
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  KAT6A_HUMAN | Q92794
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KAT6A_HUMAN | Q927941m36 2ln0 2ozu 2rc4 3v43 4lk9 4lka 4llb 5b75 5b76 5b77 5b78

(-) Related Entries Specified in the PDB File

2ln0 4lk9 4llb