Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE LIGAND-FREE INACTIVE MATRIPTASE
 
Authors :  M. D. Huang, B. Y. Zhao, C. Yuan, R. Li
Date :  16 Jan 13  (Deposition) - 06 Mar 13  (Release) - 15 May 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.48
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  A  (2x)
Keywords :  Beta Barrel, Serine Protease, Epithelium, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. Zhao, C. Yuan, R. Li, D. Qu, M. Huang, J. C. Ngo
Crystal Structures Of Matriptase In Complex With Its Inhibitor Hepatocyte Growth Factor Activator Inhibitor-1.
J. Biol. Chem. V. 288 11155 2013
PubMed-ID: 23443661  |  Reference-DOI: 10.1074/JBC.M113.454611

(-) Compounds

Molecule 1 - SUPPRESSOR OF TUMORIGENICITY 14 PROTEIN
    ChainsA
    EC Number3.4.21.109
    EngineeredYES
    Expression SystemKOMAGATAELLA PASTORIS
    Expression System CommonPICHIA PASTORIS
    Expression System PlasmidPPICZALPHAA
    Expression System StrainX-33
    Expression System Taxid4922
    Expression System Vector TypePLASMID
    FragmentSERINE PROTEASE DOMAIN (UNP RESISDUES 615-855)
    GenePRSS14, SNC19, ST14, TADG15
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMATRIPTASE, MEMBRANE-TYPE SERINE PROTEASE 1, MT-SP1, PROSTAMIN, SERINE PROTEASE 14, SERINE PROTEASE TADG-15, TUMOR- ASSOCIATED DIFFERENTIALLY-EXPRESSED GENE 15 PROTEIN

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (1x)A
Biological Unit 2 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 8)

Asymmetric Unit (3, 8)
No.NameCountTypeFull Name
1GOL3Ligand/IonGLYCEROL
2GSH1Ligand/IonGLUTATHIONE
3SO44Ligand/IonSULFATE ION
Biological Unit 1 (3, 8)
No.NameCountTypeFull Name
1GOL3Ligand/IonGLYCEROL
2GSH1Ligand/IonGLUTATHIONE
3SO44Ligand/IonSULFATE ION
Biological Unit 2 (3, 16)
No.NameCountTypeFull Name
1GOL6Ligand/IonGLYCEROL
2GSH2Ligand/IonGLUTATHIONE
3SO48Ligand/IonSULFATE ION

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:34 , LEU A:36 , GLY A:37 , GLN A:38 , GLY A:39 , ARG A:76 , HOH A:586 , HOH A:593BINDING SITE FOR RESIDUE SO4 A 301
2AC2SOFTWAREHIS A:57 , GLN A:192 , GLY A:193 , ALA A:195 , GOL A:303 , HOH A:431 , HOH A:501BINDING SITE FOR RESIDUE SO4 A 302
3AC3SOFTWARESER A:190 , CYS A:191 , GLN A:192 , GLY A:193 , ASP A:194 , ALA A:195 , VAL A:213 , SER A:214 , TRP A:215 , GLY A:216 , SO4 A:302 , HOH A:422 , HOH A:438 , HOH A:491BINDING SITE FOR RESIDUE GOL A 303
4AC4SOFTWAREGLN A:81 , GLU A:82 , ARG A:83 , GLU A:113 , HOH A:554BINDING SITE FOR RESIDUE GOL A 304
5AC5SOFTWAREVAL A:129 , LYS A:134 , ALA A:135 , ARG A:161 , HOH A:439 , HOH A:440 , HOH A:478 , HOH A:522 , HOH A:542BINDING SITE FOR RESIDUE SO4 A 305
6AC6SOFTWAREGLU A:26 , TRP A:137 , LYS A:157 , VAL A:202BINDING SITE FOR RESIDUE GOL A 306
7AC7SOFTWAREARG A:60C , ARG A:60F , SER A:90 , HOH A:487 , HOH A:494 , HOH A:533 , HOH A:628BINDING SITE FOR RESIDUE SO4 A 307
8AC8SOFTWARETRP A:29 , TYR A:114 , ARG A:119 , PRO A:120 , CYS A:122 , ARG A:206 , ILE A:207 , HOH A:443 , HOH A:540 , HOH A:579 , HOH A:588BINDING SITE FOR RESIDUE GSH A 308

(-) SS Bonds  (3, 3)

Asymmetric Unit
No.Residues
1A:42 -A:58
2A:168 -A:182
3A:191 -A:220

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4IS5)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4IS5)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4IS5)

(-) Exons   (0, 0)

(no "Exon" information available for 4IS5)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:241
                                                                                                                                                                                                                                                                                  
               SCOP domains d4is5a_ A: Matriptase MTSP1                                                                                                                                                                                                                       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeee...eeeeeeee....eeeehhhhhh........hhh.eeeee.............eeeeeeeeee.............eeeee..........................eeeeee..............eeeeeee.hhhhhhhhh.......eeeee...............eeeee.....eeeeeeeee..........eeee.hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4is5 A   16 VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIQQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDAGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV  244
                                    25        35        45        55     ||60E||||    66        76 |      85        95       105       115       125       135       145  ||   156       166       176       185 |     194       204|      213   ||  223       233       243 
                                                                       60A||||||||               77A                                                                    148|                               184A  |               204A          217|  |                       
                                                                        60B|||||||                                                                                       150                                  186A                              219  |                       
                                                                         60C||||||                                                                                                                                                                221A                       
                                                                          60D|||||                                                                                                                                                                                           
                                                                           60E||||                                                                                                                                                                                           
                                                                            60F|||                                                                                                                                                                                           
                                                                             60G||                                                                                                                                                                                           
                                                                              60H|                                                                                                                                                                                           
                                                                               60I                                                                                                                                                                                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4IS5)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4IS5)

(-) Gene Ontology  (17, 17)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GSH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4is5)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4is5
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ST14_HUMAN | Q9Y5Y6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.109
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ST14_HUMAN | Q9Y5Y6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ST14_HUMAN | Q9Y5Y61eaw 1eax 2fmv 2gv6 2gv7 3bn9 3ncl 3nps 3p8f 3p8g 3so3 4isl 4isn 4iso 4jyt 4jz1 4jzi 4o97 4o9v 4r0i

(-) Related Entries Specified in the PDB File

4isl 4isn 4iso