Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF 3-HYDROXYDECANOYL-ACYL CARRIER PROTEIN DEHYDRATASE (FABA) FROM PSEUDOMONAS AERUGINOSA
 
Authors :  L. Moynie, S. A. Mcmahon, F. G. Duthie, J. H. Naismith
Date :  25 Jun 12  (Deposition) - 27 Mar 13  (Release) - 27 Mar 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.02
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  E,F  (1x)
Biol. Unit 4:  G,H  (1x)
Biol. Unit 5:  I,J  (1x)
Keywords :  Lyase, Hot Dog Fold, Fatty Acid Biosynthesis, Bacterial Virulence (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. Moynie, S. M. Leckie, S. A. Mcmahon, F. G. Duthie, A. Koehnke, J. W. Taylor, M. S. Alphey, R. Brenk, A. D. Smith, J. H. Naismith
Structural Insights Into The Mechanism And Inhibition Of Th Beta-Hydroxydecanoyl-Acyl Carrier Protein Dehydratase From Pseudomonas Aeruginosa
J. Mol. Biol. V. 425 365 2013
PubMed-ID: 23174186  |  Reference-DOI: 10.1016/J.JMB.2012.11.017

(-) Compounds

Molecule 1 - 3-HYDROXYDECANOYL-[ACYL-CARRIER-PROTEIN] DEHYDRATASE
    Chains: A, B, C, D, E, F, G, H, I, J
    EC Number: 4.2.1.60
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PDEST14
    Expression System Strain: TUNER(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: FABA, PA1610
    Organism Scientific: PSEUDOMONAS AERUGINOSA
    Organism Taxid: 208964
    Strain: PA01
    Synonym: BETA-HYDROXYDECANOYL THIOESTER DEHYDRASE

 Structural Features

(-) Chains, Units

  12345678910
Asymmetric Unit : ABCDEFGHIJ
Biological Unit 1 (1x): AB        
Biological Unit 2 (1x):   CD      
Biological Unit 3 (1x):     EF    
Biological Unit 4 (1x):       GH  
Biological Unit 5 (1x):         IJ

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 22)

Asymmetric Unit (2, 22)
No.NameCountTypeFull Name
1GOL12Ligand/IonGLYCEROL
2PO410Ligand/IonPHOSPHATE ION
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
1GOL2Ligand/IonGLYCEROL
2PO42Ligand/IonPHOSPHATE ION
Biological Unit 2 (2, 5)
No.NameCountTypeFull Name
1GOL3Ligand/IonGLYCEROL
2PO42Ligand/IonPHOSPHATE ION
Biological Unit 3 (2, 5)
No.NameCountTypeFull Name
1GOL3Ligand/IonGLYCEROL
2PO42Ligand/IonPHOSPHATE ION
Biological Unit 4 (2, 4)
No.NameCountTypeFull Name
1GOL2Ligand/IonGLYCEROL
2PO42Ligand/IonPHOSPHATE ION
Biological Unit 5 (2, 4)
No.NameCountTypeFull Name
1GOL2Ligand/IonGLYCEROL
2PO42Ligand/IonPHOSPHATE ION

(-) Sites  (22, 22)

Asymmetric Unit (22, 22)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:84 , TRP A:87 , GLN A:88 , GOL A:204 , HOH A:342 , HOH A:343 , HOH A:344 , HIS B:70BINDING SITE FOR RESIDUE PO4 A 201
02AC2SOFTWAREHIS A:70 , PHE A:71 , GOL A:203 , HOH A:346 , HOH A:347 , ASP B:84 , TRP B:87 , GLN B:88BINDING SITE FOR RESIDUE PO4 A 202
03AC3SOFTWAREHIS A:70 , PHE A:71 , VAL A:76 , MET A:77 , GLY A:79 , PO4 A:202 , HOH A:341 , HOH A:346 , ARG B:104 , ALA B:105 , HOH B:250BINDING SITE FOR RESIDUE GOL A 203
04AC4SOFTWAREARG A:104 , ALA A:105 , PO4 A:201 , HOH A:304 , HOH A:317 , HOH A:344 , HIS B:70 , PHE B:71 , MET B:77 , GLY B:79BINDING SITE FOR RESIDUE GOL A 204
05AC5SOFTWAREASP C:84 , TRP C:87 , GLN C:88 , HOH C:325 , HOH C:358 , HOH C:382 , HIS D:70 , GOL D:202BINDING SITE FOR RESIDUE PO4 C 201
06AC6SOFTWAREGLN C:4 , ALA C:6 , ASP C:11 , GLU G:72 , GLY H:18 , PRO H:23 , GLY H:24 , GLN H:27 , ARG H:102 , HOH H:313BINDING SITE FOR RESIDUE GOL C 202
07AC7SOFTWAREHIS C:70 , PHE C:71 , VAL C:76 , MET C:77 , GLY C:79 , HOH C:380 , ARG D:104 , ALA D:105 , PO4 D:201 , HOH D:335BINDING SITE FOR RESIDUE GOL C 203
08AC8SOFTWAREHIS C:70 , GOL C:203 , ASP D:84 , TRP D:87 , GLN D:88 , HOH D:328 , HOH D:335 , HOH D:368 , HOH D:370BINDING SITE FOR RESIDUE PO4 D 201
09AC9SOFTWAREARG C:104 , ALA C:105 , PO4 C:201 , HOH C:358 , HOH C:381 , HIS D:70 , PHE D:71 , PRO D:78 , GLY D:79 , HOH D:367BINDING SITE FOR RESIDUE GOL D 202
10BC1SOFTWAREASP E:84 , TRP E:87 , GLN E:88 , GOL E:203 , HOH E:363 , HOH E:364 , HOH E:366 , HIS F:70BINDING SITE FOR RESIDUE PO4 E 201
11BC2SOFTWAREGLN E:4 , ALA E:6 , ASP E:11 , GLY G:18 , PRO G:23 , GLY G:24 , GLN G:27 , ARG G:102 , HOH G:343 , GLU H:72BINDING SITE FOR RESIDUE GOL E 202
12BC3SOFTWAREARG E:104 , ALA E:105 , PO4 E:201 , HOH E:362 , HOH E:366 , HIS F:70 , PHE F:71 , VAL F:76 , GLY F:79BINDING SITE FOR RESIDUE GOL E 203
13BC4SOFTWAREHIS E:70 , PHE E:71 , MET E:77 , PRO E:78 , GLY E:79 , HOH E:361 , ARG F:104 , ALA F:105 , PHE F:171 , PO4 F:201 , HOH F:320 , HOH F:361BINDING SITE FOR RESIDUE GOL E 204
14BC5SOFTWAREHIS E:70 , PHE E:71 , GOL E:204 , ASP F:84 , TRP F:87 , GLN F:88 , HOH F:320 , HOH F:359 , HOH F:360 , HOH F:361BINDING SITE FOR RESIDUE PO4 F 201
15BC6SOFTWAREPRO G:29 , ASP G:84 , TRP G:87 , GLN G:88 , GOL G:202 , HOH G:369 , HOH G:385 , HOH G:386 , HIS H:70 , PHE H:71BINDING SITE FOR RESIDUE PO4 G 201
16BC7SOFTWAREARG G:104 , ALA G:105 , PHE G:171 , PO4 G:201 , HOH G:384 , HOH G:386 , HIS H:70 , PHE H:71 , VAL H:76 , GLY H:79BINDING SITE FOR RESIDUE GOL G 202
17BC8SOFTWAREHIS G:70 , PHE G:71 , GLY G:79 , PHE G:113 , HOH G:315 , ARG H:104 , ALA H:105 , PO4 H:201BINDING SITE FOR RESIDUE GOL G 203
18BC9SOFTWAREHIS G:70 , GOL G:203 , PRO H:29 , ASP H:84 , TRP H:87 , GLN H:88 , HOH H:331 , HOH H:356BINDING SITE FOR RESIDUE PO4 H 201
19CC1SOFTWAREPRO I:29 , ASP I:84 , TRP I:87 , GLN I:88 , GOL I:202 , HOH I:344 , HOH I:355 , HIS J:70 , PHE J:71BINDING SITE FOR RESIDUE PO4 I 201
20CC2SOFTWAREARG I:104 , ALA I:105 , PHE I:171 , PO4 I:201 , HOH I:356 , HIS J:70 , MET J:77 , GLY J:79 , PHE J:113BINDING SITE FOR RESIDUE GOL I 202
21CC3SOFTWAREHIS I:70 , PHE I:71 , PRO J:29 , ASP J:84 , TRP J:87 , GLN J:88 , GOL J:202 , HOH J:342 , HOH J:343 , HOH J:344BINDING SITE FOR RESIDUE PO4 J 201
22CC4SOFTWAREHIS I:70 , GLY I:79 , ARG J:104 , ALA J:105 , PO4 J:201 , HOH J:315 , HOH J:342BINDING SITE FOR RESIDUE GOL J 202

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4FQ9)

(-) Cis Peptide Bonds  (20, 20)

Asymmetric Unit
No.Residues
1Pro A:31 -Asn A:32
2His A:70 -Phe A:71
3Pro B:31 -Asn B:32
4His B:70 -Phe B:71
5Pro C:31 -Asn C:32
6His C:70 -Phe C:71
7Pro D:31 -Asn D:32
8His D:70 -Phe D:71
9Pro E:31 -Asn E:32
10His E:70 -Phe E:71
11Pro F:31 -Asn F:32
12His F:70 -Phe F:71
13Pro G:31 -Asn G:32
14His G:70 -Phe G:71
15Pro H:31 -Asn H:32
16His H:70 -Phe H:71
17Pro I:31 -Asn I:32
18His I:70 -Phe I:71
19Pro J:31 -Asn J:32
20His J:70 -Phe J:71

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4FQ9)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4FQ9)

(-) Exons   (0, 0)

(no "Exon" information available for 4FQ9)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:170
                                                                                                                                                                                                          
               SCOP domains d4fq9a_ A: automated matches                                                                                                                                               SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhh....................eeeeee.........eeeeeee....hhhhhhh.......hhhhhhhhhhhhhhhhhhhh....eeeeeee..eee.........eeeeeeeeeeee....eeeeeeeeeee..eeeeeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4fq9 A   2 TKQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMIDRIVHISDVGGKYGKGELVAELDINPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPTAKKVTYNIHIKRTINRSLVLAIADGTVSVDGREIYSAEGLRVGLFTSTDSF 171
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171


Chain B from PDB  Type:PROTEIN  Length:170
                                                                                                                                                                                                          
               SCOP domains d4fq9b_ B: automated matches                                                                                                                                               SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhh....................eeeeee.........eeeeeee....hhhhhhh.......hhhhhhhhhhhhhhhhhhhh....eeeeeee.eeee.........eeeeeeeeeeeee...eeeeeeeeeee..eeeeeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4fq9 B   2 TKQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMIDRIVHISDVGGKYGKGELVAELDINPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPTAKKVTYNIHIKRTINRSLVLAIADGTVSVDGREIYSAEGLRVGLFTSTDSF 171
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171


Chain C from PDB  Type:PROTEIN  Length:170
                                                                                                                                                                                                          
               SCOP domains d4fq9c_ C: automated matches                                                                                                                                               SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhh....................eeeeee.........eeeeeee....hhhhhhh.......hhhhhhhhhhhhhhhhhhhh....eeeeeee..eee.........eeeeeeeeeeeee...eeeeeeeeeee..eeeeeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4fq9 C   2 TKQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMIDRIVHISDVGGKYGKGELVAELDINPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPTAKKVTYNIHIKRTINRSLVLAIADGTVSVDGREIYSAEGLRVGLFTSTDSF 171
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171


Chain D from PDB  Type:PROTEIN  Length:170
                                                                                                                                                                                                          
               SCOP domains d4fq9d_ D: automated matches                                                                                                                                               SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhh....................eeeeee.........eeeeeee....hhhhhhh.......hhhhhhhhhhhhhhhhhhhh....eeeeeee.eeee.........eeeeeeeeeeeee...eeeeeeeeeee..eeeeeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4fq9 D   2 TKQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMIDRIVHISDVGGKYGKGELVAELDINPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPTAKKVTYNIHIKRTINRSLVLAIADGTVSVDGREIYSAEGLRVGLFTSTDSF 171
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171


Chain E from PDB  Type:PROTEIN  Length:170
                                                                                                                                                                                                          
               SCOP domains d4fq9e_ E: automated matches                                                                                                                                               SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhh....................eeeeee.........eeeeeee....hhhhhhh.......hhhhhhhhhhhhhhhhhhhh....eeeeeee.eeee.........eeeeeeeeeeeee...eeeeeeeeeee..eeeeeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4fq9 E   2 TKQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMIDRIVHISDVGGKYGKGELVAELDINPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPTAKKVTYNIHIKRTINRSLVLAIADGTVSVDGREIYSAEGLRVGLFTSTDSF 171
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171


Chain F from PDB  Type:PROTEIN  Length:170
                                                                                                                                                                                                          
               SCOP domains d4fq9f_ F: automated matches                                                                                                                                               SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhh....................eeeeee.........eeeeeee....hhhhhhh.......hhhhhhhhhhhhhhhhhhhh....eeeeeee..eee.........eeeeeeeeeeeee...eeeeeeeeeee..eeeeeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4fq9 F   2 TKQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMIDRIVHISDVGGKYGKGELVAELDINPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPTAKKVTYNIHIKRTINRSLVLAIADGTVSVDGREIYSAEGLRVGLFTSTDSF 171
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171


Chain G from PDB  Type:PROTEIN  Length:170
                                                                                                                                                                                                          
               SCOP domains d4fq9g_ G: automated matches                                                                                                                                               SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhh....................eeeeee.........eeeeeee....hhhhhhh.......hhhhhhhhhhhhhhhhhhhh....eeeeeee.eeee.........eeeeeeeeeeeee...eeeeeeeeeee..eeeeeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4fq9 G   2 TKQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMIDRIVHISDVGGKYGKGELVAELDINPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPTAKKVTYNIHIKRTINRSLVLAIADGTVSVDGREIYSAEGLRVGLFTSTDSF 171
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171


Chain H from PDB  Type:PROTEIN  Length:170
                                                                                                                                                                                                          
               SCOP domains d4fq9h_ H: automated matches                                                                                                                                               SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhh....................eeeeee.........eeeeeee....hhhhhhh.......hhhhhhhhhhhhhhhhhhhh....eeeeeee..eee.........eeeeeeeeeeeee...eeeeeeeeeee..eeeeeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4fq9 H   2 TKQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMIDRIVHISDVGGKYGKGELVAELDINPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPTAKKVTYNIHIKRTINRSLVLAIADGTVSVDGREIYSAEGLRVGLFTSTDSF 171
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171


Chain I from PDB  Type:PROTEIN  Length:171
                                                                                                                                                                                                           
               SCOP domains d4fq9i_ I: automated matches                                                                                                                                                SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhh....................eeeeee.........eeeeeee....hhhhhhh.......hhhhhhhhhhhhhhhhhhhh....eeeeeee..eee.........eeeeeeeeeeeee...eeeeeeeeeee..eeeeeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4fq9 I   1 MTKQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMIDRIVHISDVGGKYGKGELVAELDINPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPTAKKVTYNIHIKRTINRSLVLAIADGTVSVDGREIYSAEGLRVGLFTSTDSF 171
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170 


Chain J from PDB  Type:PROTEIN  Length:170
                                                                                                                                                                                                          
               SCOP domains d4fq9j_ J: automated matches                                                                                                                                               SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhh....................eeeeee.........eeeeeee....hhhhhhh.......hhhhhhhhhhhhhhhhhhhh....eeeeeee.eeee.........eeeeeeeeeeeee...eeeeeeeeeee..eeeeeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4fq9 J   2 TKQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMIDRIVHISDVGGKYGKGELVAELDINPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPTAKKVTYNIHIKRTINRSLVLAIADGTVSVDGREIYSAEGLRVGLFTSTDSF 171
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 10)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4FQ9)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4FQ9)

(-) Gene Ontology  (11, 11)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    His A:70 - Phe A:71   [ RasMol ]  
    His B:70 - Phe B:71   [ RasMol ]  
    His C:70 - Phe C:71   [ RasMol ]  
    His D:70 - Phe D:71   [ RasMol ]  
    His E:70 - Phe E:71   [ RasMol ]  
    His F:70 - Phe F:71   [ RasMol ]  
    His G:70 - Phe G:71   [ RasMol ]  
    His H:70 - Phe H:71   [ RasMol ]  
    His I:70 - Phe I:71   [ RasMol ]  
    His J:70 - Phe J:71   [ RasMol ]  
    Pro A:31 - Asn A:32   [ RasMol ]  
    Pro B:31 - Asn B:32   [ RasMol ]  
    Pro C:31 - Asn C:32   [ RasMol ]  
    Pro D:31 - Asn D:32   [ RasMol ]  
    Pro E:31 - Asn E:32   [ RasMol ]  
    Pro F:31 - Asn F:32   [ RasMol ]  
    Pro G:31 - Asn G:32   [ RasMol ]  
    Pro H:31 - Asn H:32   [ RasMol ]  
    Pro I:31 - Asn I:32   [ RasMol ]  
    Pro J:31 - Asn J:32   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format | Biol. Unit 5 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4fq9
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FABA_PSEAE | O33877
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.2.1.60
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  FABA_PSEAE | O33877
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FABA_PSEAE | O33877: 4b0b 4b0c 4b0i 4b0j 4b8u 4cl6

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4FQ9)