Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)

(-) Description

Title :  SPECIFICITY AND STRUCTURE OF A HIGH AFFINITY ACTIVIN-LIKE 1 (ALK1) SIGNALING COMPLEX
 
Authors :  S. A. Townson, E. Martinez-Hackert, C. Greppi, P. Lowden, D. Sako, J. Li J. A. Ucran, K. Liharska, K. W. Underwood, J. Seehra, R. Kumar, A. V. Gri
Date :  22 May 12  (Deposition) - 20 Jun 12  (Release) - 29 Aug 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.36
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,a,b,c,d,e,f,g,h,i,j,k,l
Biol. Unit 1:  A,B,C,D,E,F  (1x)
Biol. Unit 2:  G,H,I,J,K,L  (1x)
Biol. Unit 3:  M,N,O,P,Q,R  (1x)
Biol. Unit 4:  S,T,U,V,W,X  (1x)
Biol. Unit 5:  a,b,c,d,e,f  (1x)
Biol. Unit 6:  g,h,i,j,k,l  (1x)
Keywords :  Tgf-Beta, Ctk, Cystine Knot, Extracellular Domain, Receptor, Signaling Protein-Signaling Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. A. Townson, E. Martinez-Hackert, C. Greppi, P. Lowden, D. Sako, J. Liu, J. A. Ucran, K. Liharska, K. W. Underwood, J. Seehra, R. Kumar, A. V. Grinberg
Specificity And Structure Of A High Affinity Activin Receptor-Like Kinase 1 (Alk1) Signaling Complex.
J. Biol. Chem. V. 287 27313 2012
PubMed-ID: 22718755  |  Reference-DOI: 10.1074/JBC.M112.377960

(-) Compounds

Molecule 1 - GROWTH/DIFFERENTIATION FACTOR 2
    ChainsA, B, G, H, M, N, S, T, a, b, g, h
    EngineeredYES
    Expression SystemCRICETULUS GRISEUS
    Expression System PlasmidPAID4
    Expression System Taxid10029
    Expression System Vector TypePLASMID
    GeneBMP9, GDF2
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymGDF-2, BONE MORPHOGENETIC PROTEIN 9, BMP-9
 
Molecule 2 - SERINE/THREONINE-PROTEIN KINASE RECEPTOR R3
    ChainsC, D, I, J, O, P, U, V, c, d, i, j
    EngineeredYES
    Expression SystemCRICETULUS GRISEUS
    Expression System PlasmidPAID4
    Expression System Taxid10029
    Expression System Vector TypePLASMID
    FragmentEXTRACELLULAR DOMAIN
    GeneACVRL1, ACVRLK1, ALK1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymSKR3, ACTIVIN RECEPTOR-LIKE KINASE 1, ALK-1, TGF-B SUPERFAMILY RECEPTOR TYPE I, TSR-I
 
Molecule 3 - ACTIVIN RECEPTOR TYPE-2B
    ChainsE, F, K, L, Q, R, W, X, e, f, k, l
    EngineeredYES
    Expression SystemCRICETULUS GRISEUS
    Expression System PlasmidPAID4
    Expression System Taxid10029
    Expression System Vector TypePLASMID
    FragmentEXTRACELLULAR DOMAIN
    GeneACTRIIB, ACVR2B
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymACTIVIN RECEPTOR TYPE IIB, ACTR-IIB

 Structural Features

(-) Chains, Units

  123456789101112131415161718192021222324252627282930313233343536
Asymmetric Unit ABCDEFGHIJKLMNOPQRSTUVWXabcdefghijkl
Biological Unit 1 (1x)ABCDEF                              
Biological Unit 2 (1x)      GHIJKL                        
Biological Unit 3 (1x)            MNOPQR                  
Biological Unit 4 (1x)                  STUVWX            
Biological Unit 5 (1x)                        abcdef      
Biological Unit 6 (1x)                              ghijkl

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 30)

Asymmetric Unit (2, 30)
No.NameCountTypeFull Name
1NA6Ligand/IonSODIUM ION
2NAG24Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
1NA-1Ligand/IonSODIUM ION
2NAG4Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 2 (1, 4)
No.NameCountTypeFull Name
1NA-1Ligand/IonSODIUM ION
2NAG4Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 3 (1, 4)
No.NameCountTypeFull Name
1NA-1Ligand/IonSODIUM ION
2NAG4Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 4 (1, 4)
No.NameCountTypeFull Name
1NA-1Ligand/IonSODIUM ION
2NAG4Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 5 (1, 4)
No.NameCountTypeFull Name
1NA-1Ligand/IonSODIUM ION
2NAG4Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 6 (1, 4)
No.NameCountTypeFull Name
1NA-1Ligand/IonSODIUM ION
2NAG4Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (30, 30)

Asymmetric Unit (30, 30)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASN E:24 , TYR f:13 , THR f:23 , ASN f:24 , LEU f:28 , GLU f:29 , NAG f:201BINDING SITE FOR RESIDUE NAG E 201
02AC2SOFTWARETRP E:45 , ASN E:47BINDING SITE FOR RESIDUE NAG E 202
03AC3SOFTWAREASN F:24 , THR e:23 , ASN e:24 , LEU e:28 , GLU e:29 , ARG e:30 , NAG e:201BINDING SITE FOR RESIDUE NAG F 201
04AC4SOFTWAREASN F:47 , SER F:49 , GLY F:50 , ILE F:52BINDING SITE FOR RESIDUE NAG F 202
05AC5SOFTWAREASN F:17 , ARG F:46BINDING SITE FOR RESIDUE NA F 203
06AC6SOFTWAREASN K:24 , TYR R:13 , THR R:23 , ASN R:24 , LEU R:28 , GLU R:29 , ARG R:30 , NAG R:201BINDING SITE FOR RESIDUE NAG K 201
07AC7SOFTWAREASN K:47 , SER K:49 , GLY K:50 , ASN K:78 , TYR K:82 , HIS K:97BINDING SITE FOR RESIDUE NAG K 202
08AC8SOFTWAREASN K:17 , ARG K:46BINDING SITE FOR RESIDUE NA K 203
09AC9SOFTWAREASN L:24 , TYR Q:13 , THR Q:23 , ASN Q:24 , LEU Q:28 , GLU Q:29 , ARG Q:30 , NAG Q:201BINDING SITE FOR RESIDUE NAG L 201
10BC1SOFTWARETRP L:45 , ASN L:47 , TYR L:82 , HIS L:97BINDING SITE FOR RESIDUE NAG L 202
11BC2SOFTWARETYR L:13 , ASN L:24 , LEU L:28 , GLU L:29 , NAG L:201 , ASN Q:24BINDING SITE FOR RESIDUE NAG Q 201
12BC3SOFTWARETRP Q:45 , ASN Q:47 , TYR Q:82 , HIS Q:97BINDING SITE FOR RESIDUE NAG Q 202
13BC4SOFTWARETYR K:13 , ASN K:24 , LEU K:28 , GLU K:29 , ARG K:30 , NAG K:201 , ASN R:24BINDING SITE FOR RESIDUE NAG R 201
14BC5SOFTWAREASN R:47 , SER R:49 , GLY R:50 , TYR R:82 , HIS R:97BINDING SITE FOR RESIDUE NAG R 202
15BC6SOFTWAREARG R:46BINDING SITE FOR RESIDUE NA R 203
16BC7SOFTWARETHR W:23 , ASN W:24 , TYR l:13 , THR l:23 , ASN l:24 , LEU l:28 , GLU l:29 , NAG l:201BINDING SITE FOR RESIDUE NAG W 201
17BC8SOFTWARETRP W:45 , ASN W:47 , HIS W:97BINDING SITE FOR RESIDUE NAG W 202
18BC9SOFTWAREASN X:24 , TYR k:13 , THR k:23 , ASN k:24 , LEU k:28 , ARG k:30 , NAG k:201BINDING SITE FOR RESIDUE NAG X 201
19CC1SOFTWARETRP X:45 , ASN X:47 , GLY X:50 , TYR X:82BINDING SITE FOR RESIDUE NAG X 202
20CC2SOFTWAREASN X:17 , ARG X:46BINDING SITE FOR RESIDUE NA X 203
21CC3SOFTWARETYR F:13 , THR F:23 , ASN F:24 , LEU F:28 , GLU F:29 , NAG F:201 , ASN e:24BINDING SITE FOR RESIDUE NAG e 201
22CC4SOFTWARETRP e:45 , ASN e:47 , SER e:49 , GLY e:50 , TYR e:82BINDING SITE FOR RESIDUE NAG e 202
23CC5SOFTWAREASN e:17 , ARG e:46BINDING SITE FOR RESIDUE NA e 203
24CC6SOFTWAREASN E:24 , LEU E:28 , GLU E:29 , ARG E:30 , NAG E:201 , ASN f:24BINDING SITE FOR RESIDUE NAG f 201
25CC7SOFTWAREASN f:47 , TYR f:82 , HIS f:97BINDING SITE FOR RESIDUE NAG f 202
26CC8SOFTWARETHR X:23 , ASN X:24 , LEU X:28 , GLU X:29 , NAG X:201 , ASN k:24BINDING SITE FOR RESIDUE NAG k 201
27CC9SOFTWAREASN k:47 , SER k:49 , GLY k:50 , HIS k:97BINDING SITE FOR RESIDUE NAG k 202
28DC1SOFTWAREASN k:17 , ARG k:46BINDING SITE FOR RESIDUE NA k 203
29DC2SOFTWAREASN W:24 , LEU W:28 , GLU W:29 , NAG W:201 , ASN l:24BINDING SITE FOR RESIDUE NAG l 201
30DC3SOFTWAREASN l:47 , ILE l:52 , TYR l:82 , HIS l:97BINDING SITE FOR RESIDUE NAG l 202

(-) SS Bonds  (162, 162)

Asymmetric Unit
No.Residues
1A:8 -A:74
2a:8 -a:74
3a:37 -a:107
4A:37 -A:107
5a:41 -a:109
6A:41 -A:109
7a:73 -b:73
8A:73 -B:73
9b:8 -b:74
10B:8 -B:74
11b:37 -b:107
12B:37 -B:107
13b:41 -b:109
14B:41 -B:109
15C:34 -C:51
16c:34 -c:51
17c:36 -c:41
18C:36 -C:41
19c:46 -c:69
20C:46 -C:69
21c:77 -c:89
22C:77 -C:89
23C:90 -C:95
24c:90 -c:95
25D:34 -D:51
26d:34 -d:51
27D:36 -D:41
28d:36 -d:41
29d:46 -d:69
30D:46 -D:69
31d:77 -d:89
32D:77 -D:89
33d:90 -d:95
34D:90 -D:95
35e:11 -e:41
36E:11 -E:41
37E:31 -E:59
38e:31 -e:59
39e:66 -e:85
40E:66 -E:85
41E:72 -E:84
42e:72 -e:84
43E:86 -E:91
44e:86 -e:91
45f:11 -f:41
46F:11 -F:41
47f:31 -f:59
48F:31 -F:59
49F:66 -F:85
50f:66 -f:85
51f:72 -f:84
52F:72 -F:84
53F:86 -F:91
54f:86 -f:91
55G:8 -G:74
56g:8 -g:74
57G:37 -G:107
58g:37 -g:107
59g:41 -g:109
60G:41 -G:109
61G:73 -H:73
62g:73 -h:73
63H:8 -H:74
64h:8 -h:74
65h:37 -h:107
66H:37 -H:107
67h:41 -h:109
68H:41 -H:109
69I:34 -I:51
70i:34 -i:51
71i:36 -i:41
72I:36 -I:41
73i:46 -i:69
74I:46 -I:69
75i:77 -i:89
76I:77 -I:89
77I:90 -I:95
78i:90 -i:95
79J:34 -J:51
80j:34 -j:51
81J:36 -J:41
82j:36 -j:41
83j:46 -j:69
84J:46 -J:69
85J:77 -J:89
86j:77 -j:89
87J:90 -J:95
88j:90 -j:95
89k:11 -k:41
90K:11 -K:41
91k:31 -k:59
92K:31 -K:59
93k:66 -k:85
94K:66 -K:85
95k:72 -k:84
96K:72 -K:84
97K:86 -K:91
98k:86 -k:91
99l:11 -l:41
100L:11 -L:41
101l:31 -l:59
102L:31 -L:59
103L:66 -L:85
104l:66 -l:85
105l:72 -l:84
106L:72 -L:84
107l:86 -l:91
108L:86 -L:91
109M:8 -M:74
110M:37 -M:107
111M:41 -M:109
112M:73 -N:73
113N:8 -N:74
114N:37 -N:107
115N:41 -N:109
116O:34 -O:51
117O:36 -O:41
118O:46 -O:69
119O:77 -O:89
120O:90 -O:95
121P:34 -P:51
122P:36 -P:41
123P:46 -P:69
124P:77 -P:89
125P:90 -P:95
126Q:11 -Q:41
127Q:31 -Q:59
128Q:66 -Q:85
129Q:72 -Q:84
130Q:86 -Q:91
131R:11 -R:41
132R:31 -R:59
133R:66 -R:85
134R:72 -R:84
135R:86 -R:91
136S:8 -S:74
137S:37 -S:107
138S:41 -S:109
139S:73 -T:73
140T:8 -T:74
141T:37 -T:107
142T:41 -T:109
143U:34 -U:51
144U:36 -U:41
145U:46 -U:69
146U:77 -U:89
147U:90 -U:95
148V:34 -V:51
149V:36 -V:41
150V:46 -V:69
151V:77 -V:89
152V:90 -V:95
153W:11 -W:41
154W:31 -W:59
155W:66 -W:85
156W:72 -W:84
157W:86 -W:91
158X:11 -X:41
159X:31 -X:59
160X:66 -X:85
161X:72 -X:84
162X:86 -X:91

(-) Cis Peptide Bonds  (24, 24)

Asymmetric Unit
No.Residues
1Ala A:28 -Pro A:29
2Phe A:43 -Pro A:44
3Ala B:28 -Pro B:29
4Phe B:43 -Pro B:44
5Ala G:28 -Pro G:29
6Phe G:43 -Pro G:44
7Ala H:28 -Pro H:29
8Phe H:43 -Pro H:44
9Ala M:28 -Pro M:29
10Phe M:43 -Pro M:44
11Ala N:28 -Pro N:29
12Phe N:43 -Pro N:44
13Ala S:28 -Pro S:29
14Phe S:43 -Pro S:44
15Ala T:28 -Pro T:29
16Phe T:43 -Pro T:44
17Ala a:28 -Pro a:29
18Phe a:43 -Pro a:44
19Ala b:28 -Pro b:29
20Phe b:43 -Pro b:44
21Ala g:28 -Pro g:29
22Phe g:43 -Pro g:44
23Ala h:28 -Pro h:29
24Phe h:43 -Pro h:44

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4FAO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4FAO)

(-) Exons   (0, 0)

(no "Exon" information available for 4FAO)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:105
                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeee.........eee..eeeeeeee.......hhhhh.hhhhhhhhhhhhhh........eeeeeeeeeeeeee.....eeeeeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 4fao A   6 SHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR 110
                                    15        25        35        45        55        65        75        85        95       105     

Chain B from PDB  Type:PROTEIN  Length:105
                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee.........eee..eeeeeeeee......hhhhh.hhhhhhhhhhhhhh........eeeeeeeeeeeeee.....eeeeeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 4fao B   6 SHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR 110
                                    15        25        35        45        55        65        75        85        95       105     

Chain C from PDB  Type:PROTEIN  Length:75
                                                                                                           
               SCOP domains --------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.........eeee..eeeeee.......eeeee....hhhhhhh.....eeeeee.............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------- Transcript
                 4fao C  30 PLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLE 104
                                    39        49        59        69        79        89        99     

Chain D from PDB  Type:PROTEIN  Length:72
                                                                                                        
               SCOP domains ------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeee.........eeee..eeeeee.......eeeee....hhhhhhh.....eeeeee........... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                 4fao D  30 PLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSL 101
                                    39        49        59        69        79        89        99  

Chain E from PDB  Type:PROTEIN  Length:91
                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.hhhhhh...eeeee........eeeeeeeeee..eeeeeeeeeee.hhhhh....eee......eeeeee........eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 4fao E   9 RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP  99
                                    18        28        38        48        58        68        78        88        98 

Chain F from PDB  Type:PROTEIN  Length:91
                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.hhhhhh...eeeee........eeeeeeeeee..eeeeeeeeeee.hhhhh....eee......eeeeee........eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 4fao F   9 RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP  99
                                    18        28        38        48        58        68        78        88        98 

Chain G from PDB  Type:PROTEIN  Length:105
                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee.........eee..eeeeeeeee......hhhhh.hhhhhhhhhhhhhh........eeeeeeeeeeeeee.....eeeeeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 4fao G   6 SHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR 110
                                    15        25        35        45        55        65        75        85        95       105     

Chain H from PDB  Type:PROTEIN  Length:105
                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee.........eee..eeeeeeeee......hhhhh.hhhhhhhhhhhhhh........eeeeeeeeeeeeee.....eeeeeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 4fao H   6 SHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR 110
                                    15        25        35        45        55        65        75        85        95       105     

Chain I from PDB  Type:PROTEIN  Length:75
                                                                                                           
               SCOP domains --------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.........eeee..eeeeee.......eeeee....hhhhhhh.....eeeeee.............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------- Transcript
                 4fao I  30 PLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLE 104
                                    39        49        59        69        79        89        99     

Chain J from PDB  Type:PROTEIN  Length:72
                                                                                                        
               SCOP domains ------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeee.........eeee..eeeeee.......eeeee....hhhhhhh.....eeeeee........... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                 4fao J  30 PLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSL 101
                                    39        49        59        69        79        89        99  

Chain K from PDB  Type:PROTEIN  Length:91
                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.hhhhhh...eeeee........eeeeeeeeee..eeeeeeeeeee.hhhhh....eee......eeeeee........eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 4fao K   9 RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP  99
                                    18        28        38        48        58        68        78        88        98 

Chain L from PDB  Type:PROTEIN  Length:91
                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.hhhhhh...eeeee........eeeeeeeeee..eeeeeeeeeee.hhhhh....eee......eeeeee........eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 4fao L   9 RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP  99
                                    18        28        38        48        58        68        78        88        98 

Chain M from PDB  Type:PROTEIN  Length:105
                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeee.........eee..eeeeeeee.......hhhhh.hhhhhhhhhhhhhh........eeeeeeeeeeeeee.....eeeeeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 4fao M   6 SHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR 110
                                    15        25        35        45        55        65        75        85        95       105     

Chain N from PDB  Type:PROTEIN  Length:104
                                                                                                                                        
               SCOP domains -------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee.hhhh....eee..eeeeeeee.......hhhhh.hhhhhhhhhhhhhh........eeeeeeeeeeeeee.....eeeeeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 4fao N   7 HCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR 110
                                    16        26        36        46        56        66        76        86        96       106    

Chain O from PDB  Type:PROTEIN  Length:75
                                                                                                           
               SCOP domains --------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.........eeee..eeeeee.......eeeee....hhhhhhh.....eeeeee.............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------- Transcript
                 4fao O  30 PLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLE 104
                                    39        49        59        69        79        89        99     

Chain P from PDB  Type:PROTEIN  Length:72
                                                                                                        
               SCOP domains ------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeee.........eeee..eeeeee.......eeeee....hhhhhhh.....eeeeee........... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                 4fao P  30 PLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSL 101
                                    39        49        59        69        79        89        99  

Chain Q from PDB  Type:PROTEIN  Length:91
                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.hhhhhh...eeeee........eeeeeeeeee..eeeeeeeeeee.hhhhh....eee......eeeeee........eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 4fao Q   9 RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP  99
                                    18        28        38        48        58        68        78        88        98 

Chain R from PDB  Type:PROTEIN  Length:91
                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.hhhhhh...eeeee........eeeeeeeeee..eeeeeeeeeee.hhhhh....eee......eeeeee........eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 4fao R   9 RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP  99
                                    18        28        38        48        58        68        78        88        98 

Chain S from PDB  Type:PROTEIN  Length:105
                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeee.........eee..eeeeeeee.......hhhhh.hhhhhhhhhhhhhh........eeeeeeeeeeeeee.....eeeeeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 4fao S   6 SHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR 110
                                    15        25        35        45        55        65        75        85        95       105     

Chain T from PDB  Type:PROTEIN  Length:105
                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee.........eee..eeeeeeeee......hhhhh.hhhhhhhhhhhhhh........eeeeeeeeeeeeee.....eeeeeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 4fao T   6 SHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR 110
                                    15        25        35        45        55        65        75        85        95       105     

Chain U from PDB  Type:PROTEIN  Length:75
                                                                                                           
               SCOP domains --------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.........eeee..eeeeee.......eeeee....hhhhhhh.....eeeeee.............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------- Transcript
                 4fao U  30 PLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLE 104
                                    39        49        59        69        79        89        99     

Chain V from PDB  Type:PROTEIN  Length:72
                                                                                                        
               SCOP domains ------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeee.........eeee..eeeeee.......eeeee....hhhhhhh.....eeeeee........... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                 4fao V  30 PLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSL 101
                                    39        49        59        69        79        89        99  

Chain W from PDB  Type:PROTEIN  Length:91
                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.hhhhhh...eeeee........eeeeeeeeee..eeeeeeeeeee.hhhhh....eee......eeeeee........eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 4fao W   9 RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP  99
                                    18        28        38        48        58        68        78        88        98 

Chain X from PDB  Type:PROTEIN  Length:91
                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.hhhhhh...eeeee........eeeeeeeeee..eeeeeeeeeee.hhhhh....eee......eeeeee........eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 4fao X   9 RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP  99
                                    18        28        38        48        58        68        78        88        98 

Chain a from PDB  Type:PROTEIN  Length:105
                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee.........eee..eeeeeeeee......hhhhh.hhhhhhhhhhhhhh........eeeeeeeeeeeeee.....eeeeeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 4fao a   6 SHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR 110
                                    15        25        35        45        55        65        75        85        95       105     

Chain b from PDB  Type:PROTEIN  Length:105
                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeee.........eee..eeeeeeee.......hhhhh.hhhhhhhhhhhhhh........eeeeeeeeeeeeee.....eeeeeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 4fao b   6 SHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR 110
                                    15        25        35        45        55        65        75        85        95       105     

Chain c from PDB  Type:PROTEIN  Length:75
                                                                                                           
               SCOP domains --------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.........eeee..eeeeee.......eeeee....hhhhhhh.....eeeeee.............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------- Transcript
                 4fao c  30 PLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLE 104
                                    39        49        59        69        79        89        99     

Chain d from PDB  Type:PROTEIN  Length:72
                                                                                                        
               SCOP domains ------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeee.........eeee..eeeeee.......eeeee....hhhhhhh.....eeeeee........... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                 4fao d  30 PLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSL 101
                                    39        49        59        69        79        89        99  

Chain e from PDB  Type:PROTEIN  Length:91
                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.hhhhhh...eeeee........eeeeeeeeee..eeeeeeeeeee.hhhhh....eee......eeeeee........eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 4fao e   9 RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP  99
                                    18        28        38        48        58        68        78        88        98 

Chain f from PDB  Type:PROTEIN  Length:91
                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.hhhhhh...eeeee........eeeeeeeeee..eeeeeeeeeee.hhhhh....eee......eeeeee........eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 4fao f   9 RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP  99
                                    18        28        38        48        58        68        78        88        98 

Chain g from PDB  Type:PROTEIN  Length:105
                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeee.........eee..eeeeeeee.......hhhhh.hhhhhhhhhhhhhh........eeeeeeeeeeeeee.....eeeeeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 4fao g   6 SHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR 110
                                    15        25        35        45        55        65        75        85        95       105     

Chain h from PDB  Type:PROTEIN  Length:105
                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee.........eee..eeeeeeeee......hhhhh.hhhhhhhhhhhhhh........eeeeeeeeeeeeee.....eeeeeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 4fao h   6 SHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR 110
                                    15        25        35        45        55        65        75        85        95       105     

Chain i from PDB  Type:PROTEIN  Length:75
                                                                                                           
               SCOP domains --------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.........eeee..eeeeee.......eeeee....hhhhhhh.....eeeeee.............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------- Transcript
                 4fao i  30 PLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLE 104
                                    39        49        59        69        79        89        99     

Chain j from PDB  Type:PROTEIN  Length:72
                                                                                                        
               SCOP domains ------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeee.........eeee..eeeeee.......eeeee....hhhhhhh.....eeeeee........... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                 4fao j  30 PLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSL 101
                                    39        49        59        69        79        89        99  

Chain k from PDB  Type:PROTEIN  Length:91
                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.hhhhhh...eeeee........eeeeeeeeee..eeeeeeeeeee.hhhhh....eee......eeeeee........eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 4fao k   9 RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP  99
                                    18        28        38        48        58        68        78        88        98 

Chain l from PDB  Type:PROTEIN  Length:91
                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.hhhhhh...eeeee........eeeeeeeeee..eeeeeeeeeee.hhhhh....eee......eeeeee........eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 4fao l   9 RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP  99
                                    18        28        38        48        58        68        78        88        98 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4FAO)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4FAO)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4FAO)

(-) Gene Ontology  (128, 176)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
    DC2  [ RasMol ]  +environment [ RasMol ]
    DC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:28 - Pro A:29   [ RasMol ]  
    Ala B:28 - Pro B:29   [ RasMol ]  
    Ala G:28 - Pro G:29   [ RasMol ]  
    Ala H:28 - Pro H:29   [ RasMol ]  
    Ala M:28 - Pro M:29   [ RasMol ]  
    Ala N:28 - Pro N:29   [ RasMol ]  
    Ala S:28 - Pro S:29   [ RasMol ]  
    Ala T:28 - Pro T:29   [ RasMol ]  
    Ala a:28 - Pro a:29   [ RasMol ]  
    Ala b:28 - Pro b:29   [ RasMol ]  
    Ala g:28 - Pro g:29   [ RasMol ]  
    Ala h:28 - Pro h:29   [ RasMol ]  
    Phe A:43 - Pro A:44   [ RasMol ]  
    Phe B:43 - Pro B:44   [ RasMol ]  
    Phe G:43 - Pro G:44   [ RasMol ]  
    Phe H:43 - Pro H:44   [ RasMol ]  
    Phe M:43 - Pro M:44   [ RasMol ]  
    Phe N:43 - Pro N:44   [ RasMol ]  
    Phe S:43 - Pro S:44   [ RasMol ]  
    Phe T:43 - Pro T:44   [ RasMol ]  
    Phe a:43 - Pro a:44   [ RasMol ]  
    Phe b:43 - Pro b:44   [ RasMol ]  
    Phe g:43 - Pro g:44   [ RasMol ]  
    Phe h:43 - Pro h:44   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4fao
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ACVL1_HUMAN | P37023
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  AVR2B_HUMAN | Q13705
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  GDF2_HUMAN | Q9UK05
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ACVL1_HUMAN | P37023
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  AVR2B_HUMAN | Q13705
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  GDF2_HUMAN | Q9UK05
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ACVL1_HUMAN | P370232lcr 3my0
        AVR2B_HUMAN | Q137052h62 2qlu
        GDF2_HUMAN | Q9UK051zkz 4mpl 4ycg 4yci 5hzw 5i05

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4FAO)