Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF KLEBSIELLA PNEUMONIAE PANTOTHENATE KINASE IN COMPLEX WITH N-PENTYLPANTOTHENAMIDE
 
Authors :  B. Li, W. Tempel, D. Smil, Y. Bolshan, B. S. Hong, H. W. Park, Structural Consortium (Sgc)
Date :  16 May 12  (Deposition) - 10 Apr 13  (Release) - 07 Aug 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A,C  (1x)
Biol. Unit 2:  B,D  (1x)
Biol. Unit 3:  E,F  (1x)
Biol. Unit 4:  G,H  (1x)
Keywords :  Structural Genomics, Structural Genomics Consortium, Sgc, P-Loop Kinase, Transferase, Biosynthetic Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. Li, W. Tempel, D. Smil, Y. Bolshan, M. Schapira, H. W. Park
Crystal Structures Of Klebsiella Pneumoniae Pantothenate Kinase In Complex With N-Substituted Pantothenamides.
Proteins V. 81 1466 2013
PubMed-ID: 23553820  |  Reference-DOI: 10.1002/PROT.24290

(-) Compounds

Molecule 1 - PANTOTHENATE KINASE
    Chains: A, C, B, D, E, F, G, H
    EC Number: 2.7.1.33
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28-MHL
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: COAA, KPK_5321
    Organism Scientific: KLEBSIELLA PNEUMONIAE
    Organism Taxid: 507522
    Strain: 342
    Synonym: PANTOTHENIC ACID KINASE

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit : ABCDEFGH
Biological Unit 1 (1x): A C     
Biological Unit 2 (1x):  B D    
Biological Unit 3 (1x):     EF  
Biological Unit 4 (1x):       GH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 55)

Asymmetric Unit (3, 55)
No.NameCountTypeFull Name
1ADP8Ligand/IonADENOSINE-5'-DIPHOSPHATE
2PN47Ligand/Ion(2R)-2,4-DIHYDROXY-3,3-DIMETHYL-N-[3-OXO-3-(PENTYLAMINO)PROPYL]BUTANAMIDE
3UNX40Ligand/IonUNKNOWN ATOM OR ION
Biological Unit 1 (3, 12)
No.NameCountTypeFull Name
1ADP2Ligand/IonADENOSINE-5'-DIPHOSPHATE
2PN42Ligand/Ion(2R)-2,4-DIHYDROXY-3,3-DIMETHYL-N-[3-OXO-3-(PENTYLAMINO)PROPYL]BUTANAMIDE
3UNX8Ligand/IonUNKNOWN ATOM OR ION
Biological Unit 2 (3, 19)
No.NameCountTypeFull Name
1ADP2Ligand/IonADENOSINE-5'-DIPHOSPHATE
2PN42Ligand/Ion(2R)-2,4-DIHYDROXY-3,3-DIMETHYL-N-[3-OXO-3-(PENTYLAMINO)PROPYL]BUTANAMIDE
3UNX15Ligand/IonUNKNOWN ATOM OR ION
Biological Unit 3 (3, 11)
No.NameCountTypeFull Name
1ADP2Ligand/IonADENOSINE-5'-DIPHOSPHATE
2PN42Ligand/Ion(2R)-2,4-DIHYDROXY-3,3-DIMETHYL-N-[3-OXO-3-(PENTYLAMINO)PROPYL]BUTANAMIDE
3UNX7Ligand/IonUNKNOWN ATOM OR ION
Biological Unit 4 (3, 13)
No.NameCountTypeFull Name
1ADP2Ligand/IonADENOSINE-5'-DIPHOSPHATE
2PN41Ligand/Ion(2R)-2,4-DIHYDROXY-3,3-DIMETHYL-N-[3-OXO-3-(PENTYLAMINO)PROPYL]BUTANAMIDE
3UNX10Ligand/IonUNKNOWN ATOM OR ION

(-) Sites  (15, 15)

Asymmetric Unit (15, 15)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASN A:1043 , ASP A:1045 , LEU A:1046 , SER A:1096 , ALA A:1098 , VAL A:1099 , GLY A:1100 , LYS A:1101 , SER A:1102 , THR A:1103 , ARG A:1243 , LYS A:1303 , HIS A:1307 , HOH A:1516 , HOH A:1521 , HOH A:1537 , HOH A:1550 , HOH A:1560 , HOH A:1568 , HOH A:1610BINDING SITE FOR RESIDUE ADP A 1401
02AC2SOFTWAREASP A:1127 , LYS A:1145 , GLY A:1146 , HIS A:1177 , TYR A:1180 , TYR A:1240 , TYR A:1258 , PHE A:1259 , TYR A:1262 , ASN A:1282 , HOH A:1521 , HOH A:1545 , HOH A:1566BINDING SITE FOR RESIDUE PN4 A 1402
03AC3SOFTWAREASN C:1043 , ASP C:1045 , TYR C:1055 , SER C:1096 , ALA C:1098 , VAL C:1099 , GLY C:1100 , LYS C:1101 , SER C:1102 , THR C:1103 , ARG C:1243 , LYS C:1303 , HIS C:1307 , HOH C:1530 , HOH C:1533 , HOH C:1537 , HOH C:1543 , HOH C:1565 , HOH C:1587 , HOH C:1588 , HOH C:1611 , HOH C:1612BINDING SITE FOR RESIDUE ADP C 1401
04AC4SOFTWAREASP C:1127 , LYS C:1145 , GLY C:1146 , HIS C:1177 , TYR C:1180 , TYR C:1240 , TYR C:1258 , PHE C:1259 , LEU C:1277 , ASN C:1282 , HOH C:1587 , HOH C:1618BINDING SITE FOR RESIDUE PN4 C 1402
05AC5SOFTWAREASN B:1043 , ASP B:1045 , LEU B:1046 , SER B:1096 , ALA B:1098 , VAL B:1099 , GLY B:1100 , LYS B:1101 , SER B:1102 , THR B:1103 , ARG B:1243 , LYS B:1303 , HIS B:1307 , HOH B:1542 , HOH B:1546 , HOH B:1548 , HOH B:1549 , HOH B:1613 , HOH B:1620BINDING SITE FOR RESIDUE ADP B 1401
06AC6SOFTWAREASP B:1127 , LYS B:1145 , GLY B:1146 , HIS B:1177 , TYR B:1180 , TYR B:1240 , TYR B:1258 , PHE B:1259 , TYR B:1262 , ASN B:1282 , HOH B:1524 , HOH B:1548 , HOH B:1574BINDING SITE FOR RESIDUE PN4 B 1402
07AC7SOFTWAREASN D:1043 , ASP D:1045 , TYR D:1055 , SER D:1096 , ALA D:1098 , VAL D:1099 , GLY D:1100 , LYS D:1101 , SER D:1102 , THR D:1103 , ARG D:1243 , LYS D:1303 , HIS D:1307 , HOH D:1505 , HOH D:1534 , HOH D:1544 , HOH D:1545 , HOH D:1546 , HOH D:1565 , HOH D:1566 , HOH D:1611 , HOH D:1635 , HOH D:1636BINDING SITE FOR RESIDUE ADP D 1401
08AC8SOFTWAREASP D:1127 , GLY D:1146 , HIS D:1177 , TYR D:1180 , TYR D:1240 , TYR D:1258 , ASN D:1282 , HOH D:1548 , HOH D:1565 , HOH D:1568BINDING SITE FOR RESIDUE PN4 D 1402
09AC9SOFTWAREASN E:1043 , ASP E:1045 , LEU E:1046 , SER E:1096 , ALA E:1098 , VAL E:1099 , GLY E:1100 , LYS E:1101 , SER E:1102 , THR E:1103 , ARG E:1243 , LYS E:1303 , HIS E:1307 , HOH E:1511 , HOH E:1579 , HOH E:1581BINDING SITE FOR RESIDUE ADP E 1401
10BC1SOFTWAREASP E:1127 , LYS E:1145 , GLY E:1146 , TYR E:1180 , TYR E:1240 , PHE E:1244 , PHE E:1259 , ILE E:1281 , ASN E:1282 , HOH E:1572BINDING SITE FOR RESIDUE PN4 E 1402
11BC2SOFTWAREASN F:1043 , ASP F:1045 , TYR F:1055 , SER F:1096 , ALA F:1098 , VAL F:1099 , GLY F:1100 , LYS F:1101 , SER F:1102 , THR F:1103 , ARG F:1243 , LYS F:1303 , HIS F:1307 , HOH F:1513 , HOH F:1523 , HOH F:1524 , HOH F:1561 , HOH F:1583 , HOH F:1605 , HOH F:1606 , HOH F:1607BINDING SITE FOR RESIDUE ADP F 1401
12BC3SOFTWAREASP F:1127 , LYS F:1145 , GLY F:1146 , HIS F:1177 , TYR F:1180 , TYR F:1240 , TYR F:1258 , PHE F:1259 , TYR F:1262 , ASN F:1282 , HOH F:1560 , HOH F:1581 , HOH F:1605BINDING SITE FOR RESIDUE PN4 F 1402
13BC4SOFTWAREASN G:1043 , ASP G:1045 , TYR G:1055 , SER G:1096 , ALA G:1098 , VAL G:1099 , GLY G:1100 , LYS G:1101 , SER G:1102 , THR G:1103 , ARG G:1243 , LYS G:1303 , HIS G:1307 , HOH G:1546 , HOH G:1549 , HOH G:1551 , HOH G:1561 , HOH G:1620 , HOH G:1621BINDING SITE FOR RESIDUE ADP G 1401
14BC5SOFTWAREASP G:1127 , LYS G:1145 , GLY G:1146 , HIS G:1177 , TYR G:1180 , TYR G:1240 , TYR G:1262 , ASN G:1282 , HOH G:1549 , HOH G:1552 , HOH G:1564 , HOH G:1622 , THR H:1253BINDING SITE FOR RESIDUE PN4 G 1402
15BC6SOFTWAREASN H:1043 , ASP H:1045 , SER H:1096 , ALA H:1098 , VAL H:1099 , GLY H:1100 , LYS H:1101 , SER H:1102 , THR H:1103 , ARG H:1243 , LYS H:1303 , HIS H:1307 , HOH H:1502 , HOH H:1563 , HOH H:1567 , HOH H:1582BINDING SITE FOR RESIDUE ADP H 1401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4F7W)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4F7W)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4F7W)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4F7W)

(-) Exons   (0, 0)

(no "Exon" information available for 4F7W)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:309
                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains d4f7wa_ A: automated matches                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeehhhhhhhhhhh....hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeeee....hhhhhhhhhhhhhhhhhhhh.eeeee.hhhh.hhhhhhhh.hhhhh.hhhhhhhhhhhhhhhhhhh....eee..ee....ee.....eee....eeeee......hhhhh.......hhhhhh.eeeeee.hhhhhhhhhhhhhhhhhhhh.......hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeee.hhh.eeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4f7w A 1008 LMTPYLQFNRHQWAALRDSVPMTLTEDEITRLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRHVELITTDGFLHPNSVLKERGLMKKKGFPQSYDMHRLVKFVSDLKSGVPQATAPVYSHLIYDVIPDGDKTVAQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEELLKSWYINRFLKFREGAFTDPDSYFHNYAKLSKEEAVDIATSLWNEINLMNLKENILPTRERASLIMTKSANHSVNQVRLRK 1316
                                  1017      1027      1037      1047      1057      1067      1077      1087      1097      1107      1117      1127      1137      1147      1157      1167      1177      1187      1197      1207      1217      1227      1237      1247      1257      1267      1277      1287      1297      1307         


Chain B from PDB  Type:PROTEIN  Length:309
                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains d4f7wb_ B: automated matches                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeehhhhhhhhhhh....hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeee.....hhhhhhhhhhhhhhhhhhhh.eeeee.hhhh.hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh.....eee..ee....ee.....eee....eeeee......hhhhh.......hhhhhh.eeeeee.hhhhhhhhhhhhhhhhhhhhhhh....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeee.hhh.eeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4f7w B 1008 LMTPYLQFNRHQWAALRDSVPMTLTEDEITRLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRHVELITTDGFLHPNSVLKERGLMKKKGFPQSYDMHRLVKFVSDLKSGVPQATAPVYSHLIYDVIPDGDKTVAQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEELLKSWYINRFLKFREGAFTDPDSYFHNYAKLSKEEAVDIATSLWNEINLMNLKENILPTRERASLIMTKSANHSVNQVRLRK 1316
                                  1017      1027      1037      1047      1057      1067      1077      1087      1097      1107      1117      1127      1137      1147      1157      1167      1177      1187      1197      1207      1217      1227      1237      1247      1257      1267      1277      1287      1297      1307         


Chain C from PDB  Type:PROTEIN  Length:309
                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains d4f7wc_ C: automated matches                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee.hhhhhhhhhh......hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeeee....hhhhhhhhhhhhhhhhhhhh.eeeee.hhhh.hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh.....eee..ee....ee.....eee....eeeee......hhhhh.......hhhhhh.eeeeee.hhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeee.hhh.eeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4f7w C 1008 LMTPYLQFNRHQWAALRDSVPMTLTEDEITRLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRHVELITTDGFLHPNSVLKERGLMKKKGFPQSYDMHRLVKFVSDLKSGVPQATAPVYSHLIYDVIPDGDKTVAQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEELLKSWYINRFLKFREGAFTDPDSYFHNYAKLSKEEAVDIATSLWNEINLMNLKENILPTRERASLIMTKSANHSVNQVRLRK 1316
                                  1017      1027      1037      1047      1057      1067      1077      1087      1097      1107      1117      1127      1137      1147      1157      1167      1177      1187      1197      1207      1217      1227      1237      1247      1257      1267      1277      1287      1297      1307         


Chain D from PDB  Type:PROTEIN  Length:308
                                                                                                                                                                                                                                                                                                                                                     
               SCOP domains d4f7wd_ D: automated matches                                                                                                                                                                                                                                                                                         SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee.hhhhhhhhhh......hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeeee....hhhhhhhhhhhhhhhhhhhh.eeeee.hhhh.hhhhhhhh.hhhhh.hhhhhhhhhhhhhhhhhh.....eeeeeee....eeeeeeeeee....eeeee......hhhhh.......hhhhhh.eeeeee.hhhhhhhhhhhhhhhhhhhhhhh....hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeee.hhh.eeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4f7w D 1009 MTPYLQFNRHQWAALRDSVPMTLTEDEITRLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRHVELITTDGFLHPNSVLKERGLMKKKGFPQSYDMHRLVKFVSDLKSGVPQATAPVYSHLIYDVIPDGDKTVAQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEELLKSWYINRFLKFREGAFTDPDSYFHNYAKLSKEEAVDIATSLWNEINLMNLKENILPTRERASLIMTKSANHSVNQVRLRK 1316
                                  1018      1028      1038      1048      1058      1068      1078      1088      1098      1108      1118      1128      1138      1148      1158      1168      1178      1188      1198      1208      1218      1228      1238      1248      1258      1268      1278      1288      1298      1308        


Chain E from PDB  Type:PROTEIN  Length:304
                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains d4f7we_ E: automated matches                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeehhhhhh....hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeeee....hhhhhhhhhhhhhh.......eeeee.hhhh.hhhhhhhh.hhhhh.hhhhhhhhhhhhhhhhhh.....eee..ee....ee.....eee....eeeee......hhhhh.......hhhhhh.eeeeee.hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeee.hhh.eeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4f7w E 1008 LMTPYLQFNRHQWAALRTLTEDEITRLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRHVELITTDGFLHPNSVLKERGLMKKKGFPQSYDMHRLVKFVSDLKSGVPQATAPVYSHLIYDVIPDGDKTVAQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEELLKSWYINRFLKFREGAFTDPDSYFHNYAKLSKEEAVDIATSLWNEINLMNLKENILPTRERASLIMTKSANHSVNQVRLRK 1316
                                  1017      1032      1042      1052      1062      1072      1082      1092      1102      1112      1122      1132      1142      1152      1162      1172      1182      1192      1202      1212      1222      1232      1242      1252      1262      1272      1282      1292      1302      1312    
                                         1024|                                                                                                                                                                                                                                                                                              
                                          1030                                                                                                                                                                                                                                                                                              


Chain F from PDB  Type:PROTEIN  Length:309
                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains d4f7wf_ F: automated matches                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee.hhhhhhhhhh......hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeee.....hhhhhhhhhhhhhhhhhhhh.eeeee.hhhh.hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh.....eee..ee....ee.....eee....eeeee......hhhhh.......hhhhhh.eeeeee.hhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4f7w F 1008 LMTPYLQFNRHQWAALRDSVPMTLTEDEITRLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRHVELITTDGFLHPNSVLKERGLMKKKGFPQSYDMHRLVKFVSDLKSGVPQATAPVYSHLIYDVIPDGDKTVAQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEELLKSWYINRFLKFREGAFTDPDSYFHNYAKLSKEEAVDIATSLWNEINLMNLKENILPTRERASLIMTKSANHSVNQVRLRK 1316
                                  1017      1027      1037      1047      1057      1067      1077      1087      1097      1107      1117      1127      1137      1147      1157      1167      1177      1187      1197      1207      1217      1227      1237      1247      1257      1267      1277      1287      1297      1307         


Chain G from PDB  Type:PROTEIN  Length:308
                                                                                                                                                                                                                                                                                                                                                     
               SCOP domains d4f7wg_ G: automated matches                                                                                                                                                                                                                                                                                         SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee.hhhhhhhhhh......hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeeee....hhhhhhhhhhhhhhhhhhhh.eeeee.hhhh.hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh.....eee..ee....ee.....eee....eeeee......hhhhh.......hhhhhh.eeeeee.hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeee.hhh.eeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4f7w G 1009 MTPYLQFNRHQWAALRDSVPMTLTEDEITRLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRHVELITTDGFLHPNSVLKERGLMKKKGFPQSYDMHRLVKFVSDLKSGVPQATAPVYSHLIYDVIPDGDKTVAQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEELLKSWYINRFLKFREGAFTDPDSYFHNYAKLSKEEAVDIATSLWNEINLMNLKENILPTRERASLIMTKSANHSVNQVRLRK 1316
                                  1018      1028      1038      1048      1058      1068      1078      1088      1098      1108      1118      1128      1138      1148      1158      1168      1178      1188      1198      1208      1218      1228      1238      1248      1258      1268      1278      1288      1298      1308        


Chain H from PDB  Type:PROTEIN  Length:303
                                                                                                                                                                                                                                                                                                                                                
               SCOP domains d4f7wh_ H: automated matches                                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeehhhhhh...hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeee.....hhhhhhhhhhhhhhhhhhhh.eeeee.hhhh.hhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eee..ee....ee.....eee....eeeee......hhhhh.......hhhhhh.eeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeee.hhh.eeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4f7w H 1008 LMTPYLQFNRHQWAALTLTEDEITRLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRHVELITTDGFLHPNSVLKERGLMKKKGFPQSYDMHRLVKFVSDLKSGVPQATAPVYSHLIYDVIPDGDKTVAQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEELLKSWYINRFLKFREGAFTDPDSYFHNYAKLSKEEAVDIATSLWNEINLMNLKENILPTRERASLIMTKSANHSVNQVRLRK 1316
                                  1017     |1033      1043      1053      1063      1073      1083      1093      1103      1113      1123      1133      1143      1153      1163      1173      1183      1193      1203      1213      1223      1233      1243      1253      1263      1273      1283      1293      1303      1313   
                                        1023|                                                                                                                                                                                                                                                                                              
                                         1030
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 8)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4F7W)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4F7W)

(-) Gene Ontology  (9, 9)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ADP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PN4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UNX  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4f7w)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4f7w
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  COAA_KLEP3 | B5XYG3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.1.33
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  COAA_KLEP3 | B5XYG3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        COAA_KLEP3 | B5XYG3: 4gi7 4ne2

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4F7W)