Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
(-)Biological Unit 7
(-)Biological Unit 8
(-)Biological Unit 9
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)
Image Biological Unit 7
Biological Unit 7  (Jmol Viewer)
Image Biological Unit 8
Biological Unit 8  (Jmol Viewer)
Image Biological Unit 9
Biological Unit 9  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF A HUMAN MITONEET MUTANT WITH ASP 67 REPLACED BY A GLY
 
Authors :  E. I. Baxter, J. A. Zuris, C. Wang, H. L. Axelrod, A. E. Cohen, M. L. Paddoc R. Nechushtai, J. N. Onuchic, P. A. Jennings
Date :  06 May 12  (Deposition) - 26 Dec 12  (Release) - 30 Jan 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  E,F  (1x)
Biol. Unit 4:  G,H  (1x)
Biol. Unit 5:  I,J  (1x)
Biol. Unit 6:  K,L  (1x)
Biol. Unit 7:  M,N  (1x)
Biol. Unit 8:  O,P  (1x)
Biol. Unit 9:  Q,R  (1x)
Keywords :  Zinc Finger Cdgsh-Type Domain 1, Mitochondrial Outer Membrane, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. L. Baxter, J. A. Zuris, C. Wang, P. L. Vo, H. L. Axelrod, A. E. Cohen, M. L. Paddock, R. Nechushtai, J. N. Onuchic, P. A. Jennings
Allosteric Control In A Metalloprotein Dramatically Alters Function.
Proc. Natl. Acad. Sci. Usa V. 110 948 2013
PubMed-ID: 23271805  |  Reference-DOI: 10.1073/PNAS.1208286110

(-) Compounds

Molecule 1 - CDGSH IRON-SULFUR DOMAIN-CONTAINING PROTEIN 1
    ChainsA, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28-A(+)
    Expression System StrainBL21-RIL
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    FragmentWATER-SOLUBLE DOMAIN, UNP RESIDUES 33-108
    GeneC10ORF70, CISD1, MDS029, ZCD1
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMITONEET

 Structural Features

(-) Chains, Units

  123456789101112131415161718
Asymmetric Unit ABCDEFGHIJKLMNOPQR
Biological Unit 1 (1x)AB                
Biological Unit 2 (1x)  CD              
Biological Unit 3 (1x)    EF            
Biological Unit 4 (1x)      GH          
Biological Unit 5 (1x)        IJ        
Biological Unit 6 (1x)          KL      
Biological Unit 7 (1x)            MN    
Biological Unit 8 (1x)              OP  
Biological Unit 9 (1x)                QR

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 18)

Asymmetric Unit (1, 18)
No.NameCountTypeFull Name
1FES18Ligand/IonFE2/S2 (INORGANIC) CLUSTER
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1FES2Ligand/IonFE2/S2 (INORGANIC) CLUSTER
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1FES2Ligand/IonFE2/S2 (INORGANIC) CLUSTER
Biological Unit 3 (1, 2)
No.NameCountTypeFull Name
1FES2Ligand/IonFE2/S2 (INORGANIC) CLUSTER
Biological Unit 4 (1, 2)
No.NameCountTypeFull Name
1FES2Ligand/IonFE2/S2 (INORGANIC) CLUSTER
Biological Unit 5 (1, 2)
No.NameCountTypeFull Name
1FES2Ligand/IonFE2/S2 (INORGANIC) CLUSTER
Biological Unit 6 (1, 2)
No.NameCountTypeFull Name
1FES2Ligand/IonFE2/S2 (INORGANIC) CLUSTER
Biological Unit 7 (1, 2)
No.NameCountTypeFull Name
1FES2Ligand/IonFE2/S2 (INORGANIC) CLUSTER
Biological Unit 8 (1, 2)
No.NameCountTypeFull Name
1FES2Ligand/IonFE2/S2 (INORGANIC) CLUSTER
Biological Unit 9 (1, 2)
No.NameCountTypeFull Name
1FES2Ligand/IonFE2/S2 (INORGANIC) CLUSTER

(-) Sites  (18, 18)

Asymmetric Unit (18, 18)
No.NameEvidenceResiduesDescription
01AC1SOFTWARECYS A:72 , ARG A:73 , CYS A:74 , CYS A:83 , ASP A:84 , ALA A:86 , HIS A:87 , PRO A:100BINDING SITE FOR RESIDUE FES A 201
02AC2SOFTWARECYS B:72 , ARG B:73 , CYS B:74 , CYS B:83 , ASP B:84 , ALA B:86 , HIS B:87BINDING SITE FOR RESIDUE FES B 201
03AC3SOFTWARECYS C:72 , ARG C:73 , CYS C:74 , SER C:77 , CYS C:83 , ASP C:84 , ALA C:86 , HIS C:87BINDING SITE FOR RESIDUE FES C 201
04AC4SOFTWARECYS D:72 , ARG D:73 , CYS D:74 , SER D:77 , CYS D:83 , ASP D:84 , ALA D:86 , HIS D:87BINDING SITE FOR RESIDUE FES D 500
05AC5SOFTWARECYS E:72 , ARG E:73 , CYS E:74 , CYS E:83 , ASP E:84 , GLY E:85 , ALA E:86 , HIS E:87BINDING SITE FOR RESIDUE FES E 201
06AC6SOFTWARECYS F:72 , ARG F:73 , CYS F:74 , CYS F:83 , ASP F:84 , ALA F:86 , HIS F:87BINDING SITE FOR RESIDUE FES F 201
07AC7SOFTWARECYS G:72 , ARG G:73 , CYS G:74 , CYS G:83 , ASP G:84 , GLY G:85 , ALA G:86 , HIS G:87BINDING SITE FOR RESIDUE FES G 201
08AC8SOFTWARECYS H:72 , ARG H:73 , CYS H:74 , SER H:77 , CYS H:83 , ASP H:84 , ALA H:86 , HIS H:87BINDING SITE FOR RESIDUE FES H 201
09AC9SOFTWARECYS I:72 , ARG I:73 , CYS I:74 , CYS I:83 , ASP I:84 , GLY I:85 , ALA I:86 , HIS I:87BINDING SITE FOR RESIDUE FES I 201
10BC1SOFTWARECYS J:72 , ARG J:73 , CYS J:74 , CYS J:83 , ASP J:84 , GLY J:85 , ALA J:86 , HIS J:87BINDING SITE FOR RESIDUE FES J 201
11BC2SOFTWARECYS K:72 , ARG K:73 , CYS K:74 , CYS K:83 , ASP K:84 , GLY K:85 , ALA K:86 , HIS K:87BINDING SITE FOR RESIDUE FES K 201
12BC3SOFTWARECYS L:72 , ARG L:73 , CYS L:74 , CYS L:83 , ASP L:84 , GLY L:85 , ALA L:86 , HIS L:87BINDING SITE FOR RESIDUE FES L 201
13BC4SOFTWARECYS M:72 , ARG M:73 , CYS M:74 , SER M:77 , CYS M:83 , ASP M:84 , GLY M:85 , ALA M:86 , HIS M:87BINDING SITE FOR RESIDUE FES M 201
14BC5SOFTWARECYS N:72 , ARG N:73 , CYS N:74 , CYS N:83 , ASP N:84 , ALA N:86 , HIS N:87BINDING SITE FOR RESIDUE FES N 201
15BC6SOFTWARECYS O:72 , ARG O:73 , CYS O:74 , CYS O:83 , ASP O:84 , ALA O:86 , HIS O:87BINDING SITE FOR RESIDUE FES O 201
16BC7SOFTWARECYS P:72 , ARG P:73 , CYS P:74 , SER P:77 , CYS P:83 , ASP P:84 , ALA P:86 , HIS P:87BINDING SITE FOR RESIDUE FES P 201
17BC8SOFTWARECYS Q:72 , ARG Q:73 , CYS Q:74 , CYS Q:83 , ASP Q:84 , ALA Q:86 , HIS Q:87BINDING SITE FOR RESIDUE FES Q 201
18BC9SOFTWARECYS R:72 , ARG R:73 , CYS R:74 , SER R:77 , CYS R:83 , ASP R:84 , ALA R:86 , HIS R:87BINDING SITE FOR RESIDUE FES R 201

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4F1E)

(-) Cis Peptide Bonds  (18, 18)

Asymmetric Unit
No.Residues
1Phe A:80 -Pro A:81
2Phe B:80 -Pro B:81
3Phe C:80 -Pro C:81
4Phe D:80 -Pro D:81
5Phe E:80 -Pro E:81
6Phe F:80 -Pro F:81
7Phe G:80 -Pro G:81
8Phe H:80 -Pro H:81
9Phe I:80 -Pro I:81
10Phe J:80 -Pro J:81
11Phe K:80 -Pro K:81
12Phe L:80 -Pro L:81
13Phe M:80 -Pro M:81
14Phe N:80 -Pro N:81
15Phe O:80 -Pro O:81
16Phe P:80 -Pro P:81
17Phe Q:80 -Pro Q:81
18Phe R:80 -Pro R:81

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4F1E)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4F1E)

(-) Exons   (0, 0)

(no "Exon" information available for 4F1E)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:65
                                                                                                 
               SCOP domains ----------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee.hhhh.eeee.............hhhhhhhhhhh..eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                 4f1e A  42 KAMINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKK 106
                                    51        61        71        81        91       101     

Chain B from PDB  Type:PROTEIN  Length:65
                                                                                                 
               SCOP domains ----------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author .............eeeeee.hhh..eeee.............hhhhhhhhhhh..eeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                 4f1e B  43 AMINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKE 107
                                    52        62        72        82        92       102     

Chain C from PDB  Type:PROTEIN  Length:66
                                                                                                  
               SCOP domains ------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..............eeeeee.hhhh.eeee.............hhhhhhhhhhh..eeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                 4f1e C  42 KAMINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKE 107
                                    51        61        71        81        91       101      

Chain D from PDB  Type:PROTEIN  Length:65
                                                                                                 
               SCOP domains ----------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author .............eeeeee.hhh..eeee.............hhhhhhhhhhh..eeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                 4f1e D  43 AMINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKE 107
                                    52        62        72        82        92       102     

Chain E from PDB  Type:PROTEIN  Length:65
                                                                                                 
               SCOP domains ----------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author ................eeee.hhhh.eeee.............hhhhhhhhhhh..eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                 4f1e E  42 KAMINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKK 106
                                    51        61        71        81        91       101     

Chain F from PDB  Type:PROTEIN  Length:65
                                                                                                 
               SCOP domains ----------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeeehhhhh.eeee.............hhhhhhhhhhh.....eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                 4f1e F  42 KAMINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKK 106
                                    51        61        71        81        91       101     

Chain G from PDB  Type:PROTEIN  Length:66
                                                                                                  
               SCOP domains ------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..............eeeeee.hhhh.eeee.............hhhhhhhhhhh..eeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                 4f1e G  42 KAMINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKE 107
                                    51        61        71        81        91       101      

Chain H from PDB  Type:PROTEIN  Length:66
                                                                                                  
               SCOP domains ------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author .............eeeeee.hhhh.eeee.............hhhhhhhhhhh..eeeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                 4f1e H  43 AMINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET 108
                                    52        62        72        82        92       102      

Chain I from PDB  Type:PROTEIN  Length:65
                                                                                                 
               SCOP domains ----------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee.hhhh.eeee.............hhhhhhhhhhh..eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                 4f1e I  42 KAMINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKK 106
                                    51        61        71        81        91       101     

Chain J from PDB  Type:PROTEIN  Length:66
                                                                                                  
               SCOP domains ------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...............eeeeee.hhhh.eeee.............hhhhhhhhhhh..eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                 4f1e J  41 NKAMINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKK 106
                                    50        60        70        80        90       100      

Chain K from PDB  Type:PROTEIN  Length:66
                                                                                                  
               SCOP domains ------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..............eeeeee.hhhh.eeee.............hhhhhhhhhhh..eeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                 4f1e K  42 KAMINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKE 107
                                    51        61        71        81        91       101      

Chain L from PDB  Type:PROTEIN  Length:64
                                                                                                
               SCOP domains ---------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------- Pfam domains
         Sec.struct. author .............eeeeee.hhhh.eeee.............hhhhhhhhhhh..eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------- Transcript
                 4f1e L  43 AMINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKK 106
                                    52        62        72        82        92       102    

Chain M from PDB  Type:PROTEIN  Length:65
                                                                                                 
               SCOP domains ----------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee.hhhh.eeee.............hhhhhhhhhhh..eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                 4f1e M  42 KAMINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKK 106
                                    51        61        71        81        91       101     

Chain N from PDB  Type:PROTEIN  Length:65
                                                                                                 
               SCOP domains ----------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee.hhhh.eeee.............hhhhhhhhhhh..eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                 4f1e N  42 KAMINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKK 106
                                    51        61        71        81        91       101     

Chain O from PDB  Type:PROTEIN  Length:62
                                                                                              
               SCOP domains -------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eeeeee.hhhh.eeee.............hhhhhhhhhhh..eeeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                 4f1e O  46 NLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKE 107
                                    55        65        75        85        95       105  

Chain P from PDB  Type:PROTEIN  Length:63
                                                                                               
               SCOP domains --------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eeeeee.hhh..eeee.............hhhhhhhhhhh..eeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------- Transcript
                 4f1e P  44 MINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKK 106
                                    53        63        73        83        93       103   

Chain Q from PDB  Type:PROTEIN  Length:64
                                                                                                
               SCOP domains ---------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eeeeee.hhhh.eeee.............hhhhhhhh.....eeeeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------- Transcript
                 4f1e Q  44 MINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKE 107
                                    53        63        73        83        93       103    

Chain R from PDB  Type:PROTEIN  Length:64
                                                                                                
               SCOP domains ---------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eeeeee.hhhh.eeee.............hhhhhhhhhhh..eeeeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------- Transcript
                 4f1e R  44 MINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKE 107
                                    53        63        73        83        93       103    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4F1E)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4F1E)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4F1E)

(-) Gene Ontology  (10, 10)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FES  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Phe A:80 - Pro A:81   [ RasMol ]  
    Phe B:80 - Pro B:81   [ RasMol ]  
    Phe C:80 - Pro C:81   [ RasMol ]  
    Phe D:80 - Pro D:81   [ RasMol ]  
    Phe E:80 - Pro E:81   [ RasMol ]  
    Phe F:80 - Pro F:81   [ RasMol ]  
    Phe G:80 - Pro G:81   [ RasMol ]  
    Phe H:80 - Pro H:81   [ RasMol ]  
    Phe I:80 - Pro I:81   [ RasMol ]  
    Phe J:80 - Pro J:81   [ RasMol ]  
    Phe K:80 - Pro K:81   [ RasMol ]  
    Phe L:80 - Pro L:81   [ RasMol ]  
    Phe M:80 - Pro M:81   [ RasMol ]  
    Phe N:80 - Pro N:81   [ RasMol ]  
    Phe O:80 - Pro O:81   [ RasMol ]  
    Phe P:80 - Pro P:81   [ RasMol ]  
    Phe Q:80 - Pro Q:81   [ RasMol ]  
    Phe R:80 - Pro R:81   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]
    Biological Unit 7  [ Jena3D ]
    Biological Unit 8  [ Jena3D ]
    Biological Unit 9  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4f1e
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CISD1_HUMAN | Q9NZ45
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CISD1_HUMAN | Q9NZ45
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CISD1_HUMAN | Q9NZ452qd0 2qh7 2r13 3ew0 3lpq 3ree 4ezf 4f28 4f2c

(-) Related Entries Specified in the PDB File

2qh7 MITONEET IS A UNIQUELY FOLDED 2FE-2S OUTER MITOCHONDRIAL MEMBRANE PROTEIN STABILIZED BY PIOGLITAZONE
3ew0 THE NOVEL 2FE-2S OUTER MITOCHONDRIAL PROTEIN MITONEET DISPLAYS CONFORMATIONAL FLEXIBILITY IN ITS N-TERMINAL CYTOPLASMIC TETHERING DOMAIN
3lpq HUMAN MITONEET WITH 2FE-2S COORDINATING LIGAND HIS 87 REPLACED WITH CYS
4ezf THE SAME PROTEIN WITH D67A, K68A MUTATIONS
4f28 THE SAME PROTEIN WITH M62G MUTATION
4f2c THE SAME PROTEIN WITH G66A, D67A MUTATIONS