Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF BX-795 COMPLEXED WITH UNPHOSPHORYLATED HUMAN TBK1 KINASE-ULD DOMAIN
 
Authors :  X. Ma, E. Helgason, Q. T. Phung, C. L. Quan, R. S. Iyer, M. W. Lee, K. K. Bowm M. A. Starovasnik, E. C. Dueber
Date :  25 Apr 12  (Deposition) - 23 May 12  (Release) - 29 Aug 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Kinase, Atp Binding, Phosphorylation, Transferase-Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  X. Ma, E. Helgason, Q. T. Phung, C. L. Quan, R. S. Iyer, M. W. Lee, K. K. Bowman, M. A. Starovasnik, E. C. Dueber
Molecular Basis Of Tank-Binding Kinase 1 Activation By Transautophosphorylation.
Proc. Natl. Acad. Sci. Usa V. 109 9378 2012
PubMed-ID: 22619329  |  Reference-DOI: 10.1073/PNAS.1121552109

(-) Compounds

Molecule 1 - SERINE/THREONINE-PROTEIN KINASE TBK1
    ChainsA, B
    EC Number2.7.11.1
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Taxid7108
    FragmentKINASE-ULD DOMAIN, UNP RESIDUES 2-385
    GeneTBK1, NAK
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymNF-KAPPA-B-ACTIVATING KINASE, T2K, TANK-BINDING KINASE 1

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 6)

Asymmetric/Biological Unit (3, 6)
No.NameCountTypeFull Name
1BX72Ligand/IonN-(3-{[5-IODO-4-({3-[(THIOPHEN-2-YLCARBONYL)AMINO]PROPYL}AMINO)PYRIMIDIN-2-YL]AMINO}PHENYL)PYRROLIDINE-1-CARBOXAMIDE
2IOD2Ligand/IonIODIDE ION
3SO42Ligand/IonSULFATE ION

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:15 , GLN A:17 , GLY A:18 , VAL A:23 , ALA A:36 , MET A:86 , GLU A:87 , CYS A:89 , PRO A:90 , GLY A:92 , GLY A:139 , MET A:142 , THR A:156 , ASP A:157 , IOD A:402BINDING SITE FOR RESIDUE BX7 A 401
2AC2SOFTWARETHR A:156 , ASP A:157 , BX7 A:401BINDING SITE FOR RESIDUE IOD A 402
3AC3SOFTWARELEU B:15 , GLN B:17 , GLY B:18 , ALA B:21 , VAL B:23 , ALA B:36 , LYS B:38 , MET B:86 , GLU B:87 , CYS B:89 , PRO B:90 , CYS B:91 , GLY B:92 , THR B:96 , GLY B:139 , MET B:142 , THR B:156 , IOD B:402 , HOH B:511BINDING SITE FOR RESIDUE BX7 B 401
4AC4SOFTWARELYS B:38 , THR B:156 , ASP B:157 , BX7 B:401BINDING SITE FOR RESIDUE IOD B 402
5AC5SOFTWAREARG A:54 , ARG A:134 , ARG A:162 , ARG B:162 , ARG B:187BINDING SITE FOR RESIDUE SO4 B 403
6AC6SOFTWAREARG A:162 , ARG A:187 , GLN A:195 , ARG B:54 , ARG B:134 , ARG B:162BINDING SITE FOR RESIDUE SO4 B 404

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4EUT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4EUT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4EUT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4EUT)

(-) Exons   (0, 0)

(no "Exon" information available for 4EUT)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:384
                                                                                                                                                                                                                                                                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eee...eeeeeeeeeee...eeeeeeee.....eeeeeee.hhhhhhhhhhhhhhhhhhhhh.......eeeeee......eeeee.....eehhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eeeee.....eeeee......ee..hhhhh..........hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh...ee.......hhhhhhhhhhh......eeee......eeee.........hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhh.eeeeeee....eeeeeee....hhhhhhhhhhhhhh.....eeee....ee...................eeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4eut A   0 GSQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSRE 385
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189||     201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381    
                                                                                                                                                                                                                        190|                                                                                                                                                                                                
                                                                                                                                                                                                                         193                                                                                                                                                                                                

Chain B from PDB  Type:PROTEIN  Length:379
                                                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee...eeeeeeeeeee...eeeeeeee.....eeeeeee.hhhhhhhhhhhhhhhhhhhhh.......eeeeee......eeeeee.....hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eeeee.....eeeee......ee...hhhhhh........hhhhhhhhh...hhhhhhhhhhhhhhhhhh...ee.......hhhhhhhhhhh......eeee......eeee.........hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhh.eeeeeee....eeeeeee....hhhhhhhhhhhhhh.hhh.eeeee..eee......hhhhh........eeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4eut B   0 GSQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSRE 385
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189 ||    206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376         
                                                                                                                                                                                                                         191|                                                                                                                                                                                          
                                                                                                                                                                                                                          199                                                                                                                                                                                          

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4EUT)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4EUT)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4EUT)

(-) Gene Ontology  (38, 38)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BX7  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IOD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4eut)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4eut
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TBK1_HUMAN | Q9UHD2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TBK1_HUMAN | Q9UHD2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TBK1_HUMAN | Q9UHD24efo 4euu 4im0 4im2 4im3 4iw0 4iwo 4iwp 4iwq 5eoa 5eof 5ep6

(-) Related Entries Specified in the PDB File

4euu