Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  THE CONSERVED DOMAIN OF YEAST CDC73
 
Authors :  H. Chen, N. Shi, Y. Gao, X. Li, L. Niu, M. Teng
Date :  06 Feb 12  (Deposition) - 22 Aug 12  (Release) - 22 Aug 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.19
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Paf1 Complex, Gtpase-Like, Transcription Elongation, Protein Binding, Nucleus, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Chen, N. Shi, Y. Gao, X. Li, M. Teng, L. Niu
Crystallographic Analysis Of The Conserved C-Terminal Domai Of Transcription Factor Cdc73 From Saccharomyces Cerevisiae Reveals A Gtpase-Like Fold.
Acta Crystallogr. , Sect. D V. 68 953 2012
PubMed-ID: 22868760  |  Reference-DOI: 10.1107/S0907444912017325

(-) Compounds

Molecule 1 - CELL DIVISION CONTROL PROTEIN 73
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentUNP RESIDUES 235-393
    GeneCDC73, YLR418C
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid559292
    StrainS288C
    SynonymRNA POLYMERASE-ASSOCIATED PROTEIN CDC73

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4DM4)

(-) Sites  (0, 0)

(no "Site" information available for 4DM4)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4DM4)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4DM4)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4DM4)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4DM4)

(-) Exons   (0, 0)

(no "Exon" information available for 4DM4)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:159
 aligned with CDC73_YEAST | Q06697 from UniProtKB/Swiss-Prot  Length:393

    Alignment length:159
                                   244       254       264       274       284       294       304       314       324       334       344       354       364       374       384         
          CDC73_YEAST   235 RKDPIILIPSAASSILTVANIKQFLLESKYVNPRNLPSVPNGLVNIEKNFERISRPIRFIIVDNTRMFTKPEYWDRVVAIFTTGHTWQFNNYQWNSPQELFQRCKGYYFHFAGDSVPQHVQQWNVEKVELDKNKRFKDVEVVRYFWHSLEKELISRGYR 393
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee............hhhhhhhhh...hhhhh......eeeeee........eeeeee.......hhhhhh.eeeeee..hhhhhh.....hhhhhhhhheeeeeee.....hhhhhhh.eeeeee...hhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4dm4 A   2 RKDPIILIPSAASSILTVANIKQFLLESKYVNPRNLPSVPNGLVNIEKNFERISRPIRFIIVDNTRMFTKPEYWDRVVAIFTTGHTWQFNNYQWNSPQELFQRCKGYYFHFAGDSVPQHVQQWNVEKVELDKNKRFKDVEVVRYFWHSLEKELISRGYR 160
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151         

Chain B from PDB  Type:PROTEIN  Length:157
 aligned with CDC73_YEAST | Q06697 from UniProtKB/Swiss-Prot  Length:393

    Alignment length:157
                                   246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       
          CDC73_YEAST   237 DPIILIPSAASSILTVANIKQFLLESKYVNPRNLPSVPNGLVNIEKNFERISRPIRFIIVDNTRMFTKPEYWDRVVAIFTTGHTWQFNNYQWNSPQELFQRCKGYYFHFAGDSVPQHVQQWNVEKVELDKNKRFKDVEVVRYFWHSLEKELISRGYR 393
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee............hhhhhhh................eeeeee........eeeeee.......hhhhhh.eeeeee..hhhhhh.....hhhhhhhhh.eeeeee.....hhhhhhh..eeeee...hhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4dm4 B   4 DPIILIPSAASSILTVANIKQFLLESKYVNPRNLPSVPNGLVNIEKNFERISRPIRFIIVDNTRMFTKPEYWDRVVAIFTTGHTWQFNNYQWNSPQELFQRCKGYYFHFAGDSVPQHVQQWNVEKVELDKNKRFKDVEVVRYFWHSLEKELISRGYR 160
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4DM4)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4DM4)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4DM4)

(-) Gene Ontology  (24, 24)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (CDC73_YEAST | Q06697)
molecular function
    GO:1990269    RNA polymerase II C-terminal domain phosphoserine binding    Interacting selectively and non-covalently with phosphorylated serine residues in the C-terminal domain of RNA polymerase II.
    GO:0000993    RNA polymerase II core binding    Interacting selectively and non-covalently with RNA polymerase II core enzyme, a multisubunit eukaryotic nuclear RNA polymerase typically composed of twelve subunits.
    GO:0003682    chromatin binding    Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0001076    transcription factor activity, RNA polymerase II transcription factor binding    Interacting selectively and non-covalently with an RNA polymerase II transcription factor, which may be a single protein or a complex, in order to modulate transcription. A protein binding transcription factor may or may not also interact with the template nucleic acid (either DNA or RNA) as well.
    GO:0001089    transcription factor activity, TFIIF-class transcription factor binding    Interacting selectively and non-covalently with a basal RNA polymerase II transcription factor of the TFIIF class in order to modulate transcription. The transcription factor may or may not also interact selectively with DNA as well.
biological process
    GO:0016570    histone modification    The covalent alteration of one or more amino acid residues within a histone protein.
    GO:0031124    mRNA 3'-end processing    Any process involved in forming the mature 3' end of an mRNA molecule.
    GO:0045910    negative regulation of DNA recombination    Any process that stops, prevents, or reduces the frequency, rate or extent of DNA recombination.
    GO:2001255    positive regulation of histone H3-K36 trimethylation    Any process that activates or increases the frequency, rate or extent of histone H3-K36 trimethylation.
    GO:2001165    positive regulation of phosphorylation of RNA polymerase II C-terminal domain serine 2 residues    Any process that activates or increases the frequency, rate or extent of phosphorylation of RNA polymerase II C-terminal domain serine 2 residues.
    GO:2001209    positive regulation of transcription elongation from RNA polymerase I promoter    Any process that activates or increases the frequency, rate or extent of transcription elongation from RNA polymerase I promoter.
    GO:0032968    positive regulation of transcription elongation from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription elongation, the extension of an RNA molecule after transcription initiation and promoter clearance by the addition of ribonucleotides, catalyzed by RNA polymerase II.
    GO:0034402    recruitment of 3'-end processing factors to RNA polymerase II holoenzyme complex    The process in which proteins required for 3'-end transcript processing become associated with the RNA polymerase II holoenzyme complex and the 3' end of a transcript.
    GO:2001173    regulation of histone H2B conserved C-terminal lysine ubiquitination    Any process that modulates the frequency, rate or extent of histone H2B conserved C-terminal lysine ubiquitination.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0090262    regulation of transcription-coupled nucleotide-excision repair    Any process that modulates the frequency, rate, or extent of the nucleotide-excision repair process that carries out preferential repair of DNA lesions on the actively transcribed strand of the DNA duplex. In addition, the transcription-coupled nucleotide-excision repair pathway is required for the recognition and repair of a small subset of lesions that are not recognized by the global genome nucleotide excision repair pathway.
    GO:0006362    transcription elongation from RNA polymerase I promoter    The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase I specific promoter by the addition of ribonucleotides catalyzed by RNA polymerase I.
    GO:0006368    transcription elongation from RNA polymerase II promoter    The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase II promoter by the addition of ribonucleotides catalyzed by RNA polymerase II.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0016593    Cdc73/Paf1 complex    A multiprotein complex that associates with RNA polymerase II and general RNA polymerase II transcription factor complexes and may be involved in both transcriptional initiation and elongation. In Saccharomyces the complex contains Paf1p, Cdc73p, Ctr9p, Rtf1p, and Leo1p.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0035327    transcriptionally active chromatin    The ordered and organized complex of DNA and protein that forms regions of the chromosome that are being actively transcribed.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4dm4)
 
  Sites
(no "Sites" information available for 4dm4)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4dm4)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4dm4
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CDC73_YEAST | Q06697
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CDC73_YEAST | Q06697
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CDC73_YEAST | Q066973v46

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4DM4)