Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF EBOLAVIRUS PROTEIN VP24 FROM RESTON
 
Authors :  A. P. P. Zhang
Date :  11 Jan 12  (Deposition) - 18 Apr 12  (Release) - 18 Apr 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Ebolavirus, Interferon Antagonist, Vp24, Stat1, Zaire, Sudan, Reston, Vp35, Karyopherin Alpha, Ifn Response Pathway, Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. P. P. Zhang, Z. A. Bornholdt, T. Liu, D. M. Abelson, D. E. Lee, S. Li, V. L. Woods Jr. , E. O. Saphire
The Ebola Virus Interferon Antagonist Vp24 Directly Binds Stat1 And Has A Novel, Pyramidal Fold
Plos Pathog. V. 8 02550 2012
PubMed-ID: 22383882  |  Reference-DOI: 10.1371/JOURNAL.PPAT.1002550

(-) Compounds

Molecule 1 - MEMBRANE-ASSOCIATED PROTEIN VP24
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 11-231
    Gene: VP24
    Organism Scientific: RESTON EBOLAVIRUS
    Organism Taxid: 129003
    Strain: RESTON

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4D9O)

(-) Sites  (0, 0)

(no "Site" information available for 4D9O)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4D9O)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Leu B:136 -Arg B:137

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4D9O)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4D9O)

(-) Exons   (0, 0)

(no "Exon" information available for 4D9O)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:202
 aligned with VP24_EBORE | Q91DD5 from UniProtKB/Swiss-Prot  Length:251

    Alignment length:222
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229  
           VP24_EBORE    10 LVPPKKDMEKGVIFSDLCNFLITQTLQGWKVYWAGIEFDVSQKGMALLTRLKTNDFAPAWAMTRNLFPHLFQNPNSVIQSPIWALRVILAAGLQDQLLDHSLVEPLTGALGLISDWLLTTTSTHFNLRTRSVKDQLSLRMLSLIRSNILQFINKLDALHVVNYNGLLSSIEIGTSTHTIIITRTNMGFLVEVQEPDKSAMNSKRPGPVKFSLLHESAFKPFT 231
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhh.eeee...eeeeee..eeeeee..hhhhhhhhh.-------.hhhhhhhhhhh....ee.hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh........hhhhhh..hhhhhhhhhhhhhhhhhhhhh...........eeeee....eeeeeee..eeeeeee.-------------.eeeeehhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4d9o A  10 MVPPKKDMEKGVIFSDLCNFLITQTLQGWKVYWAGIEFDVSQKGMALLTRLKT-------AMTRNLFPHLFQNPNSVIQSPIWALRVILAAGLQDQLLDHSLVEPLTGALGLISDWLLTTTSTHFNLRTRSVKDQLSLRMLSLIRSNILQFINKLDALHVVNYNGLLSSIEIGTSTHTIIITRTNMGFLVEVQE-------------VKFSLLHESAFKPFT 231
                                    19        29        39        49        59  |      -|       79        89        99       109       119       129       139       149       159       169       179       189       199   |     -       219       229  
                                                                               62      70                                                                                                                                  203           217              


Chain B from PDB  Type:PROTEIN  Length:193
 aligned with VP24_EBORE | Q91DD5 from UniProtKB/Swiss-Prot  Length:251

    Alignment length:217
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       
           VP24_EBORE    15 KDMEKGVIFSDLCNFLITQTLQGWKVYWAGIEFDVSQKGMALLTRLKTNDFAPAWAMTRNLFPHLFQNPNSVIQSPIWALRVILAAGLQDQLLDHSLVEPLTGALGLISDWLLTTTSTHFNLRTRSVKDQLSLRMLSLIRSNILQFINKLDALHVVNYNGLLSSIEIGTSTHTIIITRTNMGFLVEVQEPDKSAMNSKRPGPVKFSLLHESAFKPFT 231
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhh..eeee...eeeeee..eeeeee..hhhhhhhhh--------.hhhhhhhhhhh...eee.hhhhhhhhhhhhhhhhhhh.----..hhhhhhhhhhhhhhh.......hhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..........eeeee....eeeeeee..eeeeeee.------------.eeeeeehhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4d9o B  15 KDMEKGVIFSDLCNFLITQTLQGWKVYWAGIEFDVSQKGMALLTRLK--------AMTRNLFPHLFQNPNSVIQSPIWALRVILAAGLQDQLLD----EPLTGALGLISDWLLTTTSTHFNLRTRSVKDQLSLRMLSLIRSNILQFINKLDALHVVNYNGLLSSIEIGTSTHTIIITRTNMGFLVEVQE------------PVKFSLLHESAFKPFT 231
                                    24        34        44        54      |  -     |  74        84        94       104   |   114       124       134       144       154       164       174       184       194        |-         - |     224       
                                                                         61       70                                   108  113                                                                                       203          216
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4D9O)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4D9O)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4D9O)

(-) Gene Ontology  (9, 9)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (VP24_EBORE | Q91DD5)
molecular function
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
    GO:0030683    evasion or tolerance by virus of host immune response    Any process, either active or passive, by which a virus avoids the effects of the host organism's immune response. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0033645    host cell endomembrane system    A collection of membranous structures involved in transport within the host cell. The main components of the endomembrane system are endoplasmic reticulum, Golgi bodies, vesicles, cell membrane and nuclear envelope. Members of the endomembrane system pass materials through each other or though the use of vesicles. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0033644    host cell membrane    Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0020002    host cell plasma membrane    The plasma membrane surrounding a host cell.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.
    GO:0055036    virion membrane    The lipid bilayer surrounding a virion.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4d9o)
 
  Sites
(no "Sites" information available for 4d9o)
 
  Cis Peptide Bonds
    Leu B:136 - Arg B:137   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4d9o
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  VP24_EBORE | Q91DD5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  VP24_EBORE | Q91DD5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4D9O)

(-) Related Entries Specified in the PDB File

3vne 3vnf