Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THREE-DIMENSIONAL RECONSTRUCTION OF INTACT HUMAN INTEGRIN ALPHAIIBBETA3 IN A PHOSPHOLIPID BILAYER NANODISC
 
Authors :  W. S. Choi, W. J. Rice, D. L. Stokes, B. S. Coller
Date :  08 Oct 13  (Deposition) - 30 Oct 13  (Release) - 08 Jan 14  (Revision)
Method :  ELECTRON MICROSCOPY
Resolution :  20.50
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Cell Adhesion, Integrin, Single Particle Reconstruction (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  W. S. Choi, W. J. Rice, D. L. Stokes, B. S. Coller
Three-Dimensional Reconstruction Of Intact Human Integrin Alphaiibbeta3; New Implications For Activation-Dependent Ligand Binding.
Blood V. 122 4165 2013
PubMed-ID: 24136164  |  Reference-DOI: 10.1182/BLOOD-2013-04-499194

(-) Compounds

Molecule 1 - INTEGRIN ALPHA-IIB
    ChainsA
    FragmentECTODOMAIN, UNP RESIDUES 32-990
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsFITTED FROM PDB ID 3FCS
    SynonymGPALPHA IIB, GPIIB, PLATELET MEMBRANE GLYCOPROTEIN IIB, CD41, INTEGRIN ALPHA-IIB HEAVY CHAIN, INTEGRIN ALPHA-IIB LIGHT CHAIN, FORM 1, INTEGRIN ALPHA-IIB LIGHT CHAIN, FORM 2
    TissueBLOOD
 
Molecule 2 - INTEGRIN BETA-3
    Cell LinePLATELET
    ChainsB
    FragmentRESIDUES 27-716
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsFITTED FROM PDB ID 3FCS
    SynonymPLATELET MEMBRANE GLYCOPROTEIN IIIA, GPIIIA, CD61
    TissueBLOOD

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 18)

Asymmetric/Biological Unit (3, 18)
No.NameCountTypeFull Name
1BMA3Ligand/IonBETA-D-MANNOSE
2MAN3Ligand/IonALPHA-D-MANNOSE
3NAG12Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:2 , LEU A:3 , ASP A:4 , SER A:404 , PRO A:452 , ASN A:570 , VAL A:571 , SER A:572BINDING SITE FOR RESIDUE NAG A3570
2AC2SOFTWARELEU A:264 , GLY A:282 , GLU A:283 , GLN A:284 , MET A:285 , ALA A:286 , LYS B:253 , ASN B:316 , LEU B:317 , GLN B:319 , ASN B:320 , SER B:510 , NAG B:3321BINDING SITE FOR RESIDUE NAG B3320
3AC3SOFTWAREASN A:15BINDING SITE FOR MONO-SACCHARIDE NAG A3015 BOUND TO ASN A 15
4AC4SOFTWAREASN B:99 , NAG B:3371BINDING SITE FOR POLY-SACCHARIDE RESIDUES NAG B3099 THROUGH NAG B3100 BOUND TO ASN B 99
5AC5SOFTWARELEU A:600 , ASP A:601 , SER B:369 , ASN B:371 , SER B:398 , GLU B:400 , NAG B:3099BINDING SITE FOR POLY-SACCHARIDE RESIDUES NAG B3371 THROUGH BMA B3373 BOUND TO ASN B 371
6AC6SOFTWAREPRO A:564 , VAL A:566 , GLN A:595 , CYS A:608 , VAL A:609 , PRO A:610 , GLN A:611 , GLN A:613 , ALA A:638 , ASN A:639 , GLU A:640 , GLY A:641 , GLU A:642 , GLY A:643 , LYS A:694 , LYS A:695 , ASN A:696 , ALA A:697 , GLN A:698 , MET B:387 , ASN B:449 , ASN B:450 , GLY B:451 , ASN B:452BINDING SITE FOR POLY-SACCHARIDE RESIDUES NAG B3452 THROUGH NAG B3453 BOUND TO ASN B 452
7AC7SOFTWAREVAL B:529 , THR B:554 , TYR B:556 , TYR B:557 , ASN B:559 , ASP B:627 , GLU B:628 , ASN B:629 , THR B:630 , ARG B:633BINDING SITE FOR POLY-SACCHARIDE RESIDUES NAG B3559 THROUGH MAN B3563 BOUND TO ASN B 559
8AC8SOFTWAREGLU A:229 , SER A:261 , LEU A:264 , ARG A:281 , NAG B:3320BINDING SITE FOR POLY-SACCHARIDE RESIDUES NAG B3321 THROUGH MAN B3323

(-) SS Bonds  (34, 34)

Asymmetric/Biological Unit
No.Residues
1A:56 -A:65
2A:107 -A:130
3A:146 -A:167
4A:473 -A:484
5A:490 -A:545
6A:602 -A:608
7A:674 -A:687
8A:826 -A:890
9A:880 -A:885
10B:5 -B:23
11B:16 -B:38
12B:26 -B:49
13B:177 -B:184
14B:374 -B:386
15B:406 -B:433
16B:437 -B:457
17B:448 -B:460
18B:462 -B:471
19B:473 -B:503
20B:486 -B:501
21B:495 -B:506
22B:508 -B:521
23B:523 -B:544
24B:528 -B:542
25B:536 -B:547
26B:560 -B:583
27B:567 -B:581
28B:575 -B:586
29B:588 -B:598
30B:601 -B:604
31B:608 -B:655
32B:614 -B:635
33B:617 -B:631
34B:663 -B:687

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Asn A:691 -Pro A:692
2Phe A:755 -Pro A:756
3Gln A:829 -Pro A:830
4Ser B:84 -Pro B:85
5Ser B:162 -Pro B:163
6Ser B:168 -Pro B:169

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (72, 72)

Asymmetric/Biological Unit (72, 72)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_014176T40IITA2B_HUMANPolymorphism5915AT9I
02UniProtVAR_003993L59PITB3_HUMANPolymorphism5918BL33P
03UniProtVAR_069920C64YITB3_HUMANDisease (GT)74554539BC38Y
04UniProtVAR_049633L66RITB3_HUMANPolymorphism36080296BL40R
05UniProtVAR_030445L86PITA2B_HUMANDisease (GT)  ---AL55P
06UniProtVAR_030473R119WITB3_HUMANDisease (GT)781062792BR93W
07UniProtVAR_030446A139VITA2B_HUMANDisease (GT)  ---AA108V
08UniProtVAR_030474Y141CITB3_HUMANDisease (GT)  ---BY115C
09UniProtVAR_010649L143WITB3_HUMANDisease (GT)121918452BL117W
10UniProtVAR_069921M144RITB3_HUMANDisease (GT)77963874BM118R
11UniProtVAR_030475D145NITB3_HUMANDisease (GT)  ---BD119N
12UniProtVAR_003998D145YITB3_HUMANDisease (GT)121918445BD119Y
13UniProtVAR_030476M150VITB3_HUMANDisease (GT)767548512BM124V
14UniProtVAR_030447C161WITA2B_HUMANDisease (GT)  ---AC130W
15UniProtVAR_030477T166IITB3_HUMANPolymorphism74708909BT140I
16UniProtVAR_030448Y174HITA2B_HUMANDisease (GT)  ---AY143H
17UniProtVAR_003994R169QITB3_HUMANPolymorphism5917BR143Q
18UniProtVAR_009885P176AITA2B_HUMANDisease (GT)  ---AP145A
19UniProtVAR_009886P176LITA2B_HUMANDisease (GT)  ---AP145L
20UniProtVAR_010651S188LITB3_HUMANDisease (GT)143146734BS162L
21UniProtVAR_030449F202CITA2B_HUMANDisease (GT)  ---AF171C
22UniProtVAR_030450T207IITA2B_HUMANDisease (GT)  ---AT176I
23UniProtVAR_030451L214PITA2B_HUMANDisease (GT)137852911AL183P
24UniProtVAR_030452F222LITA2B_HUMANDisease (GT)  ---AF191L
25UniProtVAR_030478L222PITB3_HUMANDisease (GT)79208797BL196P
26UniProtVAR_003999R240QITB3_HUMANDisease (GT)121918444BR214Q
27UniProtVAR_004000R240WITB3_HUMANDisease (GT)121918446BR214W
28UniProtVAR_030479R242QITB3_HUMANDisease (GT)377162158BR216Q
29UniProtVAR_030480D243VITB3_HUMANDisease (GT)  ---BD217V
30UniProtVAR_069922G247DITB3_HUMANDisease (GT)79560904BG221D
31UniProtVAR_030453G267EITA2B_HUMANDisease (GT)  ---AG236E
32UniProtVAR_003979G273DITA2B_HUMANDisease (GT)137852907AG242D
33UniProtVAR_069923K279MITB3_HUMANDisease (GT)79775494BK253M
34UniProtVAR_030481L288PITB3_HUMANDisease (GT)  ---BL262P
35UniProtVAR_004001H306PITB3_HUMANDisease (GT)13306476BH280P
36UniProtVAR_054820G313AITA2B_HUMANPolymorphism1126554AG282A
37UniProtVAR_009887F320SITA2B_HUMANDisease (GT)  ---AF289S
38UniProtVAR_030482M321LITB3_HUMANDisease (GT)  ---BM295L
39UniProtVAR_030454V329FITA2B_HUMANDisease (GT)  ---AV298F
40UniProtVAR_030483I330NITB3_HUMANDisease (GT)  ---BI304N
41UniProtVAR_009888E355KITA2B_HUMANDisease (GT)137852910AE324K
42UniProtVAR_003980R358HITA2B_HUMANDisease (GT)137852908AR327H
43UniProtVAR_030455G380DITA2B_HUMANDisease (GT)766006685AG349D
44UniProtVAR_030456I405TITA2B_HUMANDisease (GT)75622274AI374T
45UniProtVAR_004002C400YITB3_HUMANDisease (GT)121918449BC374Y
46UniProtVAR_030457G412RITA2B_HUMANDisease (GT)780786843AG381R
47UniProtVAR_003995P433AITB3_HUMANPolymorphism121918448BP407A
48UniProtVAR_003981G449DITA2B_HUMANDisease (GT)  ---AG418D
49UniProtVAR_014178V453IITB3_HUMANPolymorphism5921BV427I
50UniProtVAR_003996R515QITB3_HUMANPolymorphism13306487BR489Q
51UniProtVAR_030484C532YITB3_HUMANDisease (GT)  ---BC506Y
52UniProtVAR_010671C568RITB3_HUMANDisease (GT)  ---BC542R
53UniProtVAR_030459A581DITA2B_HUMANDisease (GT)  ---AA550D
54UniProtVAR_004003C586FITB3_HUMANDisease (GT)  ---BC560F
55UniProtVAR_030485C586RITB3_HUMANDisease (GT)  ---BC560R
56UniProtVAR_030460I596TITA2B_HUMANDisease (GT)76811038AI565T
57UniProtVAR_004004G598SITB3_HUMANDisease (GT)  ---BG572S
58UniProtVAR_030486C601RITB3_HUMANDisease (GT)747534508BC575R
59UniProtVAR_010672G605SITB3_HUMANDisease (GT)144884023BG579S
60UniProtVAR_054821V649LITA2B_HUMANPolymorphism7207402AV618L
61UniProtVAR_003997R662CITB3_HUMANPolymorphism151219882BR636C
62UniProtVAR_030461C705RITA2B_HUMANDisease (GT)77961246AC674R
63UniProtVAR_030462L752VITA2B_HUMANDisease (GT)761174160AL721V
64UniProtVAR_030463R755PITA2B_HUMANDisease (GT)763762304AR724P
65UniProtVAR_003982Q778PITA2B_HUMANDisease (GT)74475415AQ747P
66UniProtVAR_030464L847PITA2B_HUMANDisease (GT)  ---AL816P
67UniProtVAR_069917V934FITA2B_HUMANDisease (GT)77458039AV903F
68UniProtVAR_030465P943LITA2B_HUMANDisease (GT)  ---AP912L
69UniProtVAR_069918S957LITA2B_HUMANDisease (GT)80002943AS926L
70UniProtVAR_014177Y968NITA2B_HUMANPolymorphism5914AY937N
71UniProtVAR_030466V982MITA2B_HUMANDisease (GT)78657866AV951M
72UniProtVAR_030467A989TITA2B_HUMANPolymorphism78165611AA958T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (4, 13)

Asymmetric/Biological Unit (4, 13)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FG_GAPPS51470 FG-GAP repeat profile.ITA2B_HUMAN35-96
110-173
187-238
306-371
251-305
373-432
435-496
  7A:4-65
A:79-142
A:156-207
A:275-340
A:220-274
A:342-401
A:404-465
2EGF_1PS00022 EGF-like domain signature 1.ITB3_HUMAN486-497
573-584
  2B:460-471
B:547-558
3EGF_2PS01186 EGF-like domain signature 2.ITB3_HUMAN486-499  1B:460-473
4INTEGRIN_BETAPS00243 Integrins beta chain cysteine-rich domain signature.ITB3_HUMAN521-534
562-575
601-614
  3B:495-508
B:536-549
B:575-588

(-) Exons   (29, 29)

Asymmetric/Biological Unit (29, 29)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002624071ENSE00000854286chr17:42466873-42466654220ITA2B_HUMAN1-63631A:2-3231
1.2ENST000002624072ENSE00000390828chr17:42463499-42463378122ITA2B_HUMAN63-104421A:32-7342
1.3ENST000002624073ENSE00000732018chr17:42463289-4246319298ITA2B_HUMAN104-136331A:73-10533
1.4ENST000002624074ENSE00000732019chr17:42463084-42462919166ITA2B_HUMAN137-192561A:106-16156
1.5ENST000002624075ENSE00001504857chr17:42462703-4246265450ITA2B_HUMAN192-208171A:161-17717
1.6ENST000002624076ENSE00001504855chr17:42462577-4246253246ITA2B_HUMAN209-224161A:178-19316
1.7ENST000002624077ENSE00000854285chr17:42462444-42462316129ITA2B_HUMAN224-267441A:193-23644
1.8ENST000002624078ENSE00001504854chr17:42461953-4246190648ITA2B_HUMAN267-283171A:236-25217
1.9ENST000002624079ENSE00000854284chr17:42461722-4246167944ITA2B_HUMAN283-297151A:252-26615
1.10ENST0000026240710ENSE00000732026chr17:42461506-4246145354ITA2B_HUMAN298-315181A:267-28418
1.11ENST0000026240711ENSE00000732027chr17:42461314-4246126253ITA2B_HUMAN316-333181A:285-30218
1.12ENST0000026240712ENSE00000732028chr17:42461072-42460861212ITA2B_HUMAN333-404721A:302-37372
1.13ENST0000026240713ENSE00000732030chr17:42458429-42458247183ITA2B_HUMAN404-465621A:373-43462
1.14ENST0000026240714ENSE00000732031chr17:42458013-4245796846ITA2B_HUMAN465-480161A:434-44916
1.15ENST0000026240715ENSE00000732032chr17:42457858-42457754105ITA2B_HUMAN480-515361A:449-48436
1.16ENST0000026240716ENSE00000732033chr17:42457669-4245761456ITA2B_HUMAN515-534201A:484-50320
1.17ENST0000026240717ENSE00000732034chr17:42457521-42457370152ITA2B_HUMAN534-584511A:503-55351
1.18ENST0000026240718ENSE00000732036chr17:42457182-42457057126ITA2B_HUMAN585-626421A:554-59542
1.19ENST0000026240719ENSE00000732038chr17:42456078-4245601168ITA2B_HUMAN627-649231A:596-61823
1.20ENST0000026240720ENSE00000732040chr17:42455877-42455730148ITA2B_HUMAN649-698501A:618-66750
1.21ENST0000026240721ENSE00000732042chr17:42455158-4245506693ITA2B_HUMAN699-729311A:668-69831
1.22ENST0000026240722ENSE00000732043chr17:42454456-4245437780ITA2B_HUMAN730-756271A:699-72527
1.23ENST0000026240723ENSE00000732044chr17:42453756-4245367681ITA2B_HUMAN756-783281A:725-75228
1.24ENST0000026240724ENSE00000732045chr17:42453552-42453453100ITA2B_HUMAN783-816341A:752-785 (gaps)34
1.25ENST0000026240725ENSE00000732046chr17:42453353-42453201153ITA2B_HUMAN817-867511A:786-83651
1.26aENST0000026240726aENSE00000732047chr17:42453084-42452959126ITA2B_HUMAN868-909421A:837-878 (gaps)42
1.27ENST0000026240727ENSE00000732049chr17:42452479-42452366114ITA2B_HUMAN910-947381A:879-91638
1.28ENST0000026240728ENSE00001321776chr17:42452128-42452027102ITA2B_HUMAN948-981341A:917-95034
1.29ENST0000026240729ENSE00000854277chr17:42451838-42451722117ITA2B_HUMAN982-1020391A:951-9599
1.30ENST0000026240730ENSE00000854276chr17:42449791-42449550242ITA2B_HUMAN1021-1039190--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:913
 aligned with ITA2B_HUMAN | P08514 from UniProtKB/Swiss-Prot  Length:1039

    Alignment length:958
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672       682       692       702       712       722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962       972       982        
          ITA2B_HUMAN    33 NLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRAL 990
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhh.eeeee..........eeeeee...eeeeeeee............eeeeee.....ee..........eeee...eeeee..........eeee..eeeeee...eeeeee..ee...ee..eeeee......eeee........hhhhhh...............eee....eeeeee.hhhhhh.eeeeeehhhhhhhh............ee.....hhhhh.......eeee.........eeeeee........eeeee.....eeeeee...........eeee........eeeeee...ee.......ee..eeeee.......ee....eeee...........eeeee........eeeeee.........eeeee.ee..ee.....eeee............eeeee........eeeeee....eeeee.....eeeeeeeee..........ee......ee.eeeeeeeeeee........eeeeeeee....hhhhh.eee......eeeeeee.......eeeeeeeee.....ee.....eeeeeeee.............eee..eeeeee...............eeeeeeee...ee......eeeeeeeee.......eeeeee......eeeeee.eeee....eeee......eeeeeee......eeeeeeeeee.........eeeeeeeee...........eeeeeeee....eeeeeeee..eeee..-----------....eeeeeeeeee.....eeeeeeeeeee........eeeeeeeee...eeeee..........----------------------------------.eeee......eeeeeeeeeee....eeeeeeeeeehhhhhh.....eeeeeeeeeeeeee...........eeeeeeeeeeee.. Sec.struct. author
             SAPs(SNPs) (1) -------I---------------------------------------------P----------------------------------------------------V---------------------W------------H-A-------------------------C----I------P-------L--------------------------------------------E-----D---------------------------------------A------S--------F-------------------------K--H---------------------D------------------------T------R------------------------------------D-----------------------------------------------------------------------------------------------------------------------------------D--------------T----------------------------------------------------L-------------------------------------------------------R----------------------------------------------V--P----------------------P--------------------------------------------------------------------P--------------------------------------------------------------------------------------F--------L-------------L----------N-------------M------T- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------------------------------------L---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE --FG_GAP  PDB: A:4-65 UniProt: 35-96                            -------------FG_GAP  PDB: A:79-142 UniProt: 110-173                          -------------FG_GAP  PDB: A:156-207 UniProt: 187-238             ------------FG_GAP  PDB: A:220-274 UniProt: 251-305                FG_GAP  PDB: A:275-340 UniProt: 306-371                           -FG_GAP  PDB: A:342-401 UniProt: 373-432                     --FG_GAP  PDB: A:404-465 UniProt: 435-496                       -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: A:2-32          ----------------------------------------Exon 1.3  PDB: A:73-105          Exon 1.4  PDB: A:106-161 UniProt: 137-192               ----------------Exon 1.6        ------------------------------------------Exon 1.8         --------------Exon 1.10         Exon 1.11         ----------------------------------------------------------------------Exon 1.13  PDB: A:373-434 UniProt: 404-465                    --------------Exon 1.15  PDB: A:449-484           ------------------Exon 1.17  PDB: A:503-553 UniProt: 534-584         Exon 1.18  PDB: A:554-595 UniProt: 585-626Exon 1.19              -------------------------------------------------Exon 1.21  PDB: A:668-698      Exon 1.22  PDB: A:699-725  --------------------------Exon 1.24  PDB: A:752-785 (gaps)  Exon 1.25  PDB: A:786-836 UniProt: 817-867         Exon 1.26a  PDB: A:837-878 (gaps)         Exon 1.27  PDB: A:879-916             Exon 1.28  PDB: A:917-950         Exon 1.29 Transcript 1 (1)
           Transcript 1 (2) ------------------------------Exon 1.2  PDB: A:32-73 UniProt: 63-104    ---------------------------------------------------------------------------------------Exon 1.5         ---------------Exon 1.7  PDB: A:193-236 UniProt: 224-267   ---------------Exon 1.9       -----------------------------------Exon 1.12  PDB: A:302-373 UniProt: 333-404                              ------------------------------------------------------------Exon 1.14       ----------------------------------Exon 1.16           ------------------------------------------------------------------------------------------------------------------Exon 1.20  PDB: A:618-667 UniProt: 649-698        ---------------------------------------------------------Exon 1.23  PDB: A:725-752   --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 4cak A   2 NLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAA-----------SWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDW----------------------------------DPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRAC 959
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761 |       -   |   781       791       801       811       821       831       | -         -         -         -  |    881       891       901       911       921       931       941       951        
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   763         775                                                             839                                874                                                                                     

Chain B from PDB  Type:PROTEIN  Length:680
 aligned with ITB3_HUMAN | P05106 from UniProtKB/Swiss-Prot  Length:788

    Alignment length:690
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716
           ITB3_HUMAN    27 GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKG 716
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...........hhhhhhhhh...eee...........eehhhhhhhh..hhh.ee....eeeeee.........----....ee..eeeeee....eeeeeeeee......eeeeeeee.hhhhhhhhhhh...hhhhhhhhhhhh..eeeeeeee.................................eeeeeeee.hhhhhhhhhh............hhhhhhhhhhhhhhhhh.....eeeeeeee.........hhhhh...............eehhhhh....hhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhhh..eeeeee.....eeeeeeee.....eee...ee.......eeeeeeeeee.......eeeeeeee......eeeeeee...hhhhh.............eeee..eeee............ee------..........hhhhh.eee....eee...........................hhh.eeee..eeee..............................eee..eee........................hhhhh.....................eee.............eeeee.....eeeee.........eee.......... Sec.struct. author
             SAPs(SNPs) (1) --------------------------------P----Y-R----------------------------------------------------W---------------------C-WRN----V---------------I--Q------------------L---------------------------------P-----------------Q-QV---D-------------------------------M--------P-----------------P--------------L--------N---------------------------------------------------------------------Y--------------------------------A-------------------I-------------------------------------------------------------Q----------------Y-----------------------------------R-----------------F-----------S--R---S--------------------------------------------------------C------------------------------------------------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------------------------------------------------------Y----------------------------------------------------------------------------------------------W---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------R---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EGF_1       ----------------------------------------------------------------INTEGRIN_BETA --------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EGF_2         ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (1) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------INTEGRIN_BETA --------------------------------------EGF_1       ----------------INTEGRIN_BETA ------------------------------------------------------------------------------------------------------ PROSITE (1)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4cak B   1 GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGS----QVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEE------QDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECCKG 690
                                    10        20        30        40        50        60        70   |    80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470     |   -  |    490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690
                                                                                                    74   79                                                                                                                                                                                                                                                                                                                                                                                                          476    483                                                                                                                                                                                                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4CAK)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4CAK)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4CAK)

(-) Gene Ontology  (81, 99)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (ITA2B_HUMAN | P08514)
molecular function
    GO:0050840    extracellular matrix binding    Interacting selectively and non-covalently with a component of the extracellular matrix.
    GO:0070051    fibrinogen binding    Interacting selectively and non-covalently with fibrinogen, a highly soluble hexameric glycoprotein complex that is found in blood plasma and is converted to fibrin by thrombin in the coagulation cascade.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
    GO:0007160    cell-matrix adhesion    The binding of a cell to the extracellular matrix via adhesion molecules.
    GO:0030198    extracellular matrix organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
    GO:0007229    integrin-mediated signaling pathway    A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0070527    platelet aggregation    The adhesion of one platelet to one or more other platelets via adhesion molecules.
    GO:0002576    platelet degranulation    The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
    GO:0002687    positive regulation of leukocyte migration    Any process that activates or increases the frequency, rate, or extent of leukocyte migration.
cellular component
    GO:0072562    blood microparticle    A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0008305    integrin complex    A protein complex that is composed of one alpha subunit and one beta subunit, both of which are members of the integrin superfamily of cell adhesion receptors; the complex spans the plasma membrane and binds to extracellular matrix ligands, cell-surface ligands, and soluble ligands.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0031092    platelet alpha granule membrane    The lipid bilayer surrounding the platelet alpha granule.

Chain B   (ITB3_HUMAN | P05106)
molecular function
    GO:0019960    C-X3-C chemokine binding    Interacting selectively and non-covalently with a C-X3-C chemokine; C-X3-C chemokines have three amino acids between the first two cysteines of the characteristic four-cysteine motif.
    GO:0050839    cell adhesion molecule binding    Interacting selectively and non-covalently with a cell adhesion molecule.
    GO:0015026    coreceptor activity    Combining with an extracellular or intracellular messenger, and in cooperation with a nearby primary receptor, initiating a change in cell activity.
    GO:0019899    enzyme binding    Interacting selectively and non-covalently with any enzyme.
    GO:0050840    extracellular matrix binding    Interacting selectively and non-covalently with a component of the extracellular matrix.
    GO:0017134    fibroblast growth factor binding    Interacting selectively and non-covalently with a fibroblast growth factor.
    GO:0001968    fibronectin binding    Interacting selectively and non-covalently with a fibronectin, a group of related adhesive glycoproteins of high molecular weight found on the surface of animal cells, connective tissue matrices, and in extracellular fluids.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0031994    insulin-like growth factor I binding    Interacting selectively and non-covalently with insulin-like growth factor I.
    GO:0038132    neuregulin binding    Interacting selectively and non-covalently with a neuregulin, a member of the EGF family of growth factors.
    GO:0005161    platelet-derived growth factor receptor binding    Interacting selectively and non-covalently with the platelet-derived growth factor receptor.
    GO:0002020    protease binding    Interacting selectively and non-covalently with any protease or peptidase.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003756    protein disulfide isomerase activity    Catalysis of the rearrangement of both intrachain and interchain disulfide bonds in proteins.
    GO:0004872    receptor activity    Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
    GO:0043184    vascular endothelial growth factor receptor 2 binding    Interacting selectively and non-covalently with vascular endothelial growth factor receptor 2.
    GO:0001618    virus receptor activity    Combining with a virus component and mediating entry of the virus into the cell.
biological process
    GO:0032147    activation of protein kinase activity    Any process that initiates the activity of an inactive protein kinase.
    GO:0060055    angiogenesis involved in wound healing    Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels and contribute to the series of events that restore integrity to a damaged tissue, following an injury.
    GO:0038027    apolipoprotein A-I-mediated signaling pathway    A series of molecular signals initiated by the binding of apolipoprotein A-I to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
    GO:0016049    cell growth    The process in which a cell irreversibly increases in size over time by accretion and biosynthetic production of matter similar to that already present.
    GO:0016477    cell migration    The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
    GO:0007160    cell-matrix adhesion    The binding of a cell to the extracellular matrix via adhesion molecules.
    GO:0031589    cell-substrate adhesion    The attachment of a cell to the underlying substrate via adhesion molecules.
    GO:0007044    cell-substrate junction assembly    The aggregation, arrangement and bonding together of a set of components to form a junction between a cell and its substrate.
    GO:0030198    extracellular matrix organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
    GO:0034113    heterotypic cell-cell adhesion    The attachment of a cell to a cell of a different type via adhesion molecules.
    GO:0007229    integrin-mediated signaling pathway    A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0050900    leukocyte migration    The movement of a leukocyte within or between different tissues and organs of the body.
    GO:0048333    mesodermal cell differentiation    The process in which a relatively unspecialized cell acquires the specialized features of a mesoderm cell.
    GO:0050919    negative chemotaxis    The directed movement of a motile cell or organism towards a lower concentration of a chemical.
    GO:0010888    negative regulation of lipid storage    Any process that decreases the rate, frequency or extent of lipid storage. Lipid storage is the accumulation and maintenance in cells or tissues of lipids, compounds soluble in organic solvents but insoluble or sparingly soluble in aqueous solvents. Lipid reserves can be accumulated during early developmental stages for mobilization and utilization at later stages of development.
    GO:0032369    negative regulation of lipid transport    Any process that stops, prevents, or reduces the frequency, rate or extent of the directed movement of lipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0050748    negative regulation of lipoprotein metabolic process    Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways involving lipoproteins, any conjugated, water-soluble protein in which the nonprotein group consists of a lipid or lipids.
    GO:0045715    negative regulation of low-density lipoprotein particle receptor biosynthetic process    Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of low-density lipoprotein particle receptors.
    GO:0010745    negative regulation of macrophage derived foam cell differentiation    Any process that decreases the rate, frequency or extent of macrophage derived foam cell differentiation. Macrophage derived foam cell differentiation is the process in which a macrophage acquires the specialized features of a foam cell. A foam cell is a type of cell containing lipids in small vacuoles and typically seen in atherosclerotic lesions, as well as other conditions.
    GO:0030168    platelet activation    A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
    GO:0070527    platelet aggregation    The adhesion of one platelet to one or more other platelets via adhesion molecules.
    GO:0002576    platelet degranulation    The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
    GO:0010595    positive regulation of endothelial cell migration    Any process that increases the rate, frequency, or extent of the orderly movement of an endothelial cell into the extracellular matrix to form an endothelium.
    GO:0001938    positive regulation of endothelial cell proliferation    Any process that activates or increases the rate or extent of endothelial cell proliferation.
    GO:0050731    positive regulation of peptidyl-tyrosine phosphorylation    Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
    GO:0001934    positive regulation of protein phosphorylation    Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
    GO:0030949    positive regulation of vascular endothelial growth factor receptor signaling pathway    Any process that activates or increases the frequency, rate or extent of vascular endothelial growth factor receptor signaling pathway activity.
    GO:0045124    regulation of bone resorption    Any process that modulates the frequency, rate or extent of bone tissue loss (resorption).
    GO:0030334    regulation of cell migration    Any process that modulates the frequency, rate or extent of cell migration.
    GO:0014909    smooth muscle cell migration    The orderly movement of a smooth muscle cell from one site to another, often during the development of a multicellular organism.
    GO:0034446    substrate adhesion-dependent cell spreading    The morphogenetic process that results in flattening of a cell as a consequence of its adhesion to a substrate.
    GO:0035295    tube development    The process whose specific outcome is the progression of a tube over time, from its initial formation to a mature structure. Epithelial and endothelial tubes transport gases, liquids and cells from one site to another and form the basic structure of many organs and tissues including lung and trachea, kidney, the mammary gland, the vascular system and the gastrointestinal and urinary-genital tracts.
    GO:0048010    vascular endothelial growth factor receptor signaling pathway    Any series of molecular signals initiated by the binding of an extracellular ligand to a vascular endothelial growth factor receptor (VEGFR) located on the surface of the receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
    GO:0042060    wound healing    The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
    GO:0035867    alphav-beta3 integrin-IGF-1-IGF1R complex    A protein complex that consists of an alphav-beta3 integrin complex bound to insulin-like growth factor-1 (IGF-1) and type I insulin-like growth factor receptor (IGF1R). IGF1R is a heterotetramer that consists of two alpha-subunits and two beta-subunits.
    GO:0071062    alphav-beta3 integrin-vitronectin complex    A protein complex that consists of an alphav-beta3 integrin complex bound to vitronectin.
    GO:0030054    cell junction    A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
    GO:0042995    cell projection    A prolongation or process extending from a cell, e.g. a flagellum or axon.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0031527    filopodium membrane    The portion of the plasma membrane surrounding a filopodium.
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0034683    integrin alphav-beta3 complex    An integrin complex that comprises one alphav subunit and one beta3 subunit.
    GO:0008305    integrin complex    A protein complex that is composed of one alpha subunit and one beta subunit, both of which are members of the integrin superfamily of cell adhesion receptors; the complex spans the plasma membrane and binds to extracellular matrix ligands, cell-surface ligands, and soluble ligands.
    GO:0031258    lamellipodium membrane    The portion of the plasma membrane surrounding a lamellipodium.
    GO:0042470    melanosome    A tissue-specific, membrane-bounded cytoplasmic organelle within which melanin pigments are synthesized and stored. Melanosomes are synthesized in melanocyte cells.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0031528    microvillus membrane    The portion of the plasma membrane surrounding a microvillus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0031092    platelet alpha granule membrane    The lipid bilayer surrounding the platelet alpha granule.
    GO:0043235    receptor complex    Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0032587    ruffle membrane    The portion of the plasma membrane surrounding a ruffle.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:691 - Pro A:692   [ RasMol ]  
    Gln A:829 - Pro A:830   [ RasMol ]  
    Phe A:755 - Pro A:756   [ RasMol ]  
    Ser B:162 - Pro B:163   [ RasMol ]  
    Ser B:168 - Pro B:169   [ RasMol ]  
    Ser B:84 - Pro B:85   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4cak
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ITA2B_HUMAN | P08514
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  ITB3_HUMAN | P05106
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  273800
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ITA2B_HUMAN | P08514
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  ITB3_HUMAN | P05106
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ITA2B_HUMAN | P085141dpk 1dpq 1jx5 1kup 1kuz 1m8o 1rn0 1s4w 1tye 1uv9 2k1a 2k9j 2knc 2mtp 2n9y 2vc2 2vdk 2vdl 2vdm 2vdn 2vdo 2vdp 2vdq 2vdr 3fcs 3fcu 3nid 3nif 3nig 3t3m 3t3p 3zdx 3zdy 3zdz 3ze0 3ze1 3ze2 4z7n 4z7o 4z7q 5hdb
        ITB3_HUMAN | P051061jv2 1kup 1kuz 1l5g 1m1x 1m8o 1miz 1mk7 1mk9 1rn0 1s4x 1tye 1u8c 2h7d 2h7e 2ini 2k9j 2knc 2kv9 2l1c 2l91 2ljd 2lje 2ljf 2mtp 2n9y 2q6w 2rmz 2rn0 2vc2 2vdk 2vdl 2vdm 2vdn 2vdo 2vdp 2vdq 2vdr 3fcs 3fcu 3ije 3nid 3nif 3nig 3t3m 3t3p 3zdx 3zdy 3zdz 3ze0 3ze1 3ze2 4g1e 4g1m 4hxj 4mmx 4mmy 4mmz 4o02 4z7n 4z7o 4z7q 5hdb

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4CAK)