Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE HETEROTRIMER OF PQBP1, U5-15KD AND U5-52KD.
 
Authors :  M. Mizuguchi, T. Obita, T. Serita, R. Kojima, T. Morimoto, Y. Nabeshima H. Okazawa
Date :  04 Jul 13  (Deposition) - 30 Apr 14  (Release) - 14 May 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,B,C  (1x)
Biol. Unit 2:  D,E,F  (1x)
Keywords :  Transcription, Neurodegenerative Disorders (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Mizuguchi, T. Obita, T. Serita, R. Kojima, Y. Nabeshima, H. Okazawa
Mutations In The Pqbp1 Gene Prevent Its Interaction With The Spliceosomal Protein U5-15Kd.
Nat. Commun. V. 5 3822 2014
PubMed-ID: 24781215  |  Reference-DOI: 10.1038/NCOMMS4822

(-) Compounds

Molecule 1 - THIOREDOXIN-LIKE PROTEIN 4A
    ChainsA, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System VariantC41
    Expression System VectorPOPTH
    Expression System Vector TypePLASMID
    FragmentRESIDUES 4-137
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymDIM1 PROTEIN HOMOLOG, SPLICEOSOMAL U5 SNRNP-SPECIFIC 15 KDA PROTEIN, THIOREDOXIN-LIKE U5 SNRNP PROTEIN U5-15KD, U5-15KD
 
Molecule 2 - POLYGLUTAMINE-BINDING PROTEIN 1
    ChainsB, E
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System VariantC41
    Expression System VectorPOPTG
    Expression System Vector TypePLASMID
    FragmentRESIDUES 223-265
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPQBP-1,38 KDA NUCLEAR PROTEIN CONTAINING A WW DOMAIN, NPW38, POLYGLUTAMINE TRACT-BINDING PROTEIN 1, PQBP-1
 
Molecule 3 - CD2 ANTIGEN CYTOPLASMIC TAIL-BINDING PROTEIN 2
    ChainsC, F
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPOPTH
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System VariantC41
    Expression System Vector TypePLASMID
    FragmentRESIDUES 280-341
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCD2 CYTOPLASMIC DOMAIN-BINDING PROTEIN 2, CD2 TAIL-BINDING PROTEIN 2, U5 SNRNP 52K PROTEIN, U5-52K, U5-52KD

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit ABCDEF
Biological Unit 1 (1x)ABC   
Biological Unit 2 (1x)   DEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4BWS)

(-) Sites  (0, 0)

(no "Site" information available for 4BWS)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4BWS)

(-) Cis Peptide Bonds  (5, 5)

Asymmetric Unit
No.Residues
1Gly C:297 -Pro C:298
2Asp C:323 -Pro C:324
3Pro E:238 -Leu E:239
4Gly F:297 -Pro F:298
5Asp F:323 -Pro F:324

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4BWS)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GYFPS50829 GYF domain profile.CD2B2_HUMAN280-338
 
  2C:280-338
F:280-338
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GYFPS50829 GYF domain profile.CD2B2_HUMAN280-338
 
  1C:280-338
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GYFPS50829 GYF domain profile.CD2B2_HUMAN280-338
 
  1-
F:280-338

(-) Exons   (6, 12)

Asymmetric Unit (6, 12)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002696011aENSE00001274525chr18:77748532-77748240293TXN4A_HUMAN1-51512A:5-51
D:5-51
47
47
1.2ENST000002696012ENSE00000950773chr18:77737701-77737598104TXN4A_HUMAN52-86352A:52-86
D:52-86
35
35
1.4ENST000002696014ENSE00000996738chr18:77733856-77732869988TXN4A_HUMAN86-142572A:86-137
D:86-137
52
52

2.1ENST000003055961ENSE00001389090chr16:30366682-30366533150CD2B2_HUMAN-00--
2.2ENST000003055962ENSE00001328785chr16:30366028-30365925104CD2B2_HUMAN1-26260--
2.3ENST000003055963ENSE00001139812chr16:30365643-30365505139CD2B2_HUMAN27-73470--
2.4ENST000003055964ENSE00001139805chr16:30365379-30365222158CD2B2_HUMAN73-125530--
2.5ENST000003055965ENSE00001139799chr16:30365121-30364689433CD2B2_HUMAN126-2701452C:276-278
F:275-278
3
4
2.6ENST000003055966ENSE00001139794chr16:30364608-30364502107CD2B2_HUMAN270-305362C:279-305
F:279-305
27
27
2.7ENST000003055967ENSE00001316361chr16:30364416-303620872330CD2B2_HUMAN306-341362C:306-341
F:306-341
36
36

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:133
 aligned with TXN4A_HUMAN | P83876 from UniProtKB/Swiss-Prot  Length:142

    Alignment length:133
                                    14        24        34        44        54        64        74        84        94       104       114       124       134   
          TXN4A_HUMAN     5 LPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS 137
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee.hhhhhhhhhh.....eeeeeee...hhhhhhhhhhhhhhhhhhh..eeeeeee...hhhhh.........eeeeee..eeeeee..............hhhhhhhhhhhhhhhhhhh..eee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: A:5-51 UniProt: 1-51           Exon 1.2  PDB: A:52-86             --------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------Exon 1.4  PDB: A:86-137 UniProt: 86-142 [INCOMPLETE] Transcript 1 (2)
                 4bws A   5 LPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS 137
                                    14        24        34        44        54        64        74        84        94       104       114       124       134   

Chain B from PDB  Type:PROTEIN  Length:22
 aligned with PQBP1_HUMAN | O60828 from UniProtKB/Swiss-Prot  Length:265

    Alignment length:22
                                   247       257  
          PQBP1_HUMAN   238 PLFQQRPYPSPGAVLRANAEAS 259
               SCOP domains ---------------------- SCOP domains
               CATH domains ---------------------- CATH domains
               Pfam domains ---------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------- SAPs(SNPs)
                    PROSITE ---------------------- PROSITE
                 Transcript ---------------------- Transcript
                 4bws B 238 PLFQQRPYPSPGAVLRANAEAS 259
                                   247       257  

Chain C from PDB  Type:PROTEIN  Length:66
 aligned with CD2B2_HUMAN | O95400 from UniProtKB/Swiss-Prot  Length:341

    Alignment length:102
                                   249       259       269       279       289       299       309       319       329       339  
          CD2B2_HUMAN   240 HNPTPPPSLDMFAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT 341
               SCOP domains ------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...------------------------------------...eeeee.........eeeeehhhhhhhhh........eeee........ee....hhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------------GYF  PDB: C:280-338 UniProt: 280-338                       --- PROSITE
           Transcript 2 (1) Exon 2.5  PDB: C:276-278       -----------------------------------Exon 2.7  PDB: C:306-341             Transcript 2 (1)
           Transcript 2 (2) ------------------------------Exon 2.6  PDB: C:279-305            ------------------------------------ Transcript 2 (2)
                 4bws C 276 HHH------------------------------------MDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT 341
                              |      -         -         -       279       289       299       309       319       329       339  
                              |                                  279                                                              
                            278                                                                                                   

Chain D from PDB  Type:PROTEIN  Length:133
 aligned with TXN4A_HUMAN | P83876 from UniProtKB/Swiss-Prot  Length:142

    Alignment length:133
                                    14        24        34        44        54        64        74        84        94       104       114       124       134   
          TXN4A_HUMAN     5 LPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS 137
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee.hhhhhhhhhhh....eeeeeee...hhhhhhhhhhhhhhhhhhh..eeeeeee.................eeeeee..eeeeee..............hhhhhhhhhhhhhhhhhhh..eee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: D:5-51 UniProt: 1-51           Exon 1.2  PDB: D:52-86             --------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------Exon 1.4  PDB: D:86-137 UniProt: 86-142 [INCOMPLETE] Transcript 1 (2)
                 4bws D   5 LPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS 137
                                    14        24        34        44        54        64        74        84        94       104       114       124       134   

Chain E from PDB  Type:PROTEIN  Length:23
 aligned with PQBP1_HUMAN | O60828 from UniProtKB/Swiss-Prot  Length:265

    Alignment length:23
                                   247       257   
          PQBP1_HUMAN   238 PLFQQRPYPSPGAVLRANAEASR 260
               SCOP domains ----------------------- SCOP domains
               CATH domains ----------------------- CATH domains
               Pfam domains ----------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------- SAPs(SNPs)
                    PROSITE ----------------------- PROSITE
                 Transcript ----------------------- Transcript
                 4bws E 238 PLFQQRPYPSPGAVLRANAEASR 260
                                   247       257   

Chain F from PDB  Type:PROTEIN  Length:67
 aligned with CD2B2_HUMAN | O95400 from UniProtKB/Swiss-Prot  Length:341

    Alignment length:102
                                   249       259       269       279       289       299       309       319       329       339  
          CD2B2_HUMAN   240 HNPTPPPSLDMFAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT 341
               SCOP domains ------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....-----------------------------------....eeee.........eeeehhhhhhhhhh........eeee........ee....hhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------------GYF  PDB: F:280-338 UniProt: 280-338                       --- PROSITE
           Transcript 2 (1) Exon 2.5  PDB: F:275-278       -----------------------------------Exon 2.7  PDB: F:306-341             Transcript 2 (1)
           Transcript 2 (2) ------------------------------Exon 2.6  PDB: F:279-305            ------------------------------------ Transcript 2 (2)
                 4bws F 275 HHHH-----------------------------------MDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT 341
                               |     -         -         -       279       289       299       309       319       329       339  
                             278                                 279                                                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4BWS)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4BWS)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4BWS)

(-) Gene Ontology  (32, 48)

Asymmetric Unit(hide GO term definitions)
Chain A,D   (TXN4A_HUMAN | P83876)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0008380    RNA splicing    The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
    GO:0000375    RNA splicing, via transesterification reactions    Splicing of RNA via a series of two transesterification reactions.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0051301    cell division    The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
    GO:0006397    mRNA processing    Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
    GO:0000398    mRNA splicing, via spliceosome    The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
    GO:0000245    spliceosomal complex assembly    The aggregation, arrangement and bonding together of a spliceosomal complex, a ribonucleoprotein apparatus that catalyzes nuclear mRNA splicing via transesterification reactions.
cellular component
    GO:0046540    U4/U6 x U5 tri-snRNP complex    A ribonucleoprotein complex formed by the association of the U4/U6 and U5 small nuclear ribonucleoproteins.
    GO:0005682    U5 snRNP    A ribonucleoprotein complex that contains small nuclear RNA U5.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005681    spliceosomal complex    Any of a series of ribonucleoprotein complexes that contain snRNA(s) and small nuclear ribonucleoproteins (snRNPs), and are formed sequentially during the spliceosomal splicing of one or more substrate RNAs, and which also contain the RNA substrate(s) from the initial target RNAs of splicing, the splicing intermediate RNA(s), to the final RNA products. During cis-splicing, the initial target RNA is a single, contiguous RNA transcript, whether mRNA, snoRNA, etc., and the released products are a spliced RNA and an excised intron, generally as a lariat structure. During trans-splicing, there are two initial substrate RNAs, the spliced leader RNA and a pre-mRNA.

Chain B,E   (PQBP1_HUMAN | O60828)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0008022    protein C-terminus binding    Interacting selectively and non-covalently with a protein C-terminus, the end of any peptide chain at which the 1-carboxy function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043021    ribonucleoprotein complex binding    Interacting selectively and non-covalently with any complex of RNA and protein.
    GO:0003713    transcription coactivator activity    Interacting selectively and non-covalently with a activating transcription factor and also with the basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
biological process
    GO:0008380    RNA splicing    The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
    GO:0000380    alternative mRNA splicing, via spliceosome    The process of generating multiple mRNA molecules from a given set of exons by differential use of exons from the primary transcript(s) to form multiple mature mRNAs that vary in their exon composition.
    GO:0060271    cilium assembly    The assembly of a cilium, a specialized eukaryotic organelle that consists of a filiform extrusion of the cell surface. Each cilium is bounded by an extrusion of the cytoplasmic membrane, and contains a regular longitudinal array of microtubules, anchored basally in a centriole.
    GO:0006397    mRNA processing    Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
    GO:0031175    neuron projection development    The process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
    GO:0043484    regulation of RNA splicing    Any process that modulates the frequency, rate or extent of RNA splicing, the process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
    GO:0048814    regulation of dendrite morphogenesis    Any process that modulates the frequency, rate or extent of dendrite morphogenesis.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0097546    ciliary base    Area of the cilium (also called flagellum) where the basal body and the axoneme are anchored to the plasma membrane. The ciliary base encompasses the distal part of the basal body, transition fibers and transition zone and is structurally and functionally very distinct from the rest of the cilium. In this area proteins are sorted and filtered before entering the cilium, and many ciliary proteins localize specifically to this area.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0010494    cytoplasmic stress granule    A dense aggregation in the cytosol composed of proteins and RNAs that appear when the cell is under stress.
    GO:0071598    neuronal ribonucleoprotein granule    A ribonucleoprotein complex that is found in the cytoplasm of axons and dendrites, and transports translationally silenced mRNAs to dendritic synapses, where they are released and translated in response to specific exogenous stimuli.
    GO:0016607    nuclear speck    A discrete extra-nucleolar subnuclear domain, 20-50 in number, in which splicing factors are seen to be localized by immunofluorescence microscopy.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C,F   (CD2B2_HUMAN | O95400)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043021    ribonucleoprotein complex binding    Interacting selectively and non-covalently with any complex of RNA and protein.
biological process
    GO:0008380    RNA splicing    The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
    GO:0006397    mRNA processing    Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
    GO:0000398    mRNA splicing, via spliceosome    The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
    GO:0010923    negative regulation of phosphatase activity    Any process that decreases the rate or frequency of phosphatase activity. Phosphatases catalyze the hydrolysis of phosphoric monoesters, releasing inorganic phosphate.
    GO:0000244    spliceosomal tri-snRNP complex assembly    The formation of a tri-snRNP complex containing U4 and U6 (or U4atac and U6atac) snRNAs and U5 snRNAs and associated proteins. This includes reannealing of U4 and U6 (or U4atac and U6atac) snRNAs released from previous rounds of splicing to reform the U4/U6 snRNP (or U4atac/U6atac snRNP) as well as the subsequent association of the U5 snRNP with the U4/U6 snRNP (or U4atac/U6atac snRNP) to form a tri-snRNP that is ready to reassemble into another spliceosome complex.
cellular component
    GO:0046540    U4/U6 x U5 tri-snRNP complex    A ribonucleoprotein complex formed by the association of the U4/U6 and U5 small nuclear ribonucleoproteins.
    GO:0005682    U5 snRNP    A ribonucleoprotein complex that contains small nuclear RNA U5.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0016607    nuclear speck    A discrete extra-nucleolar subnuclear domain, 20-50 in number, in which splicing factors are seen to be localized by immunofluorescence microscopy.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4bws)
 
  Sites
(no "Sites" information available for 4bws)
 
  Cis Peptide Bonds
    Asp C:323 - Pro C:324   [ RasMol ]  
    Asp F:323 - Pro F:324   [ RasMol ]  
    Gly C:297 - Pro C:298   [ RasMol ]  
    Gly F:297 - Pro F:298   [ RasMol ]  
    Pro E:238 - Leu E:239   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4bws
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CD2B2_HUMAN | O95400
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PQBP1_HUMAN | O60828
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  TXN4A_HUMAN | P83876
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CD2B2_HUMAN | O95400
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PQBP1_HUMAN | O60828
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TXN4A_HUMAN | P83876
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CD2B2_HUMAN | O954001gyf 1l2z 1syx
        PQBP1_HUMAN | O608284bwq 4cdo
        TXN4A_HUMAN | P838761pqn 1qgv 1syx 3jcr 4bwq 4cdo

(-) Related Entries Specified in the PDB File

4bwq CRYSTAL STRUCTURE OF U5-15KD IN A COMPLEX WITH PQBP1